CAZyme Information: MGYG000000013_02943

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_02943
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000000013_7|CGC2	36786.76	8.4189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 72515; End: 73486 Strand: -

Full Sequence      

MKRTIFKGMMCLLLLGVGVTSVYSQQQQRKDTLVVARDGTGDYRNIQEAVEAVRAFMDYT
VTIFIKNGVYKEKLVIPSWVKNVQLVGESAEKTIITYDDHANINKMGTFRTYTVKVEGND
ITFKDLTIENNAAPLGQAVALHTEGDRLMFVNCRFLGNQDTIYTGSERTRLLFTNCYIEG
TTDFIFGPSTALFEYCELHSKRDSYITAASTPQSEEFGYVFKNCKLTAAPDVKKVYLGRP
WRPYAATVFINCEFGNHIRPEGWHNWKNPENEKTARYAEFGNTGAGADTTGRVTWAKQLT
KKEITKYTPENIFKESSNWYPYK

Enzyme Prediction     

No EC number prediction in MGYG000000013_02943.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	33	314	1.8e-107	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.76e-83	34	311	3	293	Pectinesterase.
PLN02773	PLN02773	2.57e-83	27	307	1	290	pectinesterase
PLN02432	PLN02432	3.15e-74	33	306	13	283	putative pectinesterase
PLN02708	PLN02708	4.51e-70	35	321	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	1.59e-69	32	303	70	351	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL41079.1	2.77e-223	1	323	1	323
QUR41788.1	2.54e-219	1	323	1	323
ALJ48951.1	5.13e-219	1	323	1	323
QGT73499.1	5.13e-219	1	323	1	323
QRQ55762.1	5.13e-219	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.06e-42	33	309	9	298	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.25e-40	34	319	6	303	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	4.43e-29	33	292	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.30e-28	33	292	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NTB_A	8.15e-24	43	321	18	339	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.06e-50	35	303	9	286	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.21e-50	30	319	270	572	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	1.97e-48	30	319	257	559	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8GX86	2.55e-48	30	323	253	557	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
O49298	2.94e-48	30	319	248	542	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001138	0.990395	0.007640	0.000284	0.000264	0.000255

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_02943.