CAZyme Information: MGYG000000013_03445

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_03445
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1288	MGYG000000013_8|CGC3	145627.24	8.2305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 285295; End: 289161 Strand: +

Full Sequence      

MNKRIFILFLFSLLLFTGSIYAAIGITDLRTEQLKNPAGIDVRQPRLSWRIESDGQNVIQ
TAYHILVASSPELLEQGKGDIWDSGKIESDASQWIAYQGKTLKRNAPYYWKVKIDTNKGT
TDWSTPAFWTTGLFNEADWQGQWIGLDKAAPGDSETQWSRLAARYLRKEFALKKEVKRAT
VHIAGMGLYELFINGQRIGNQVLAPAPTDYRKTILYNTYDVTSLLQTENAIGVTLGNGRF
YTMRQNYKPYKIPTFGYPKLRLNLIVEYADGSKETIASNTTWKLTTDGPIRSNNEYDGEE
YDARKELGNWTQTGYDDKSWMPAQRVSIPSGTLRAQMMPGMKVTETLKPVSIKKLGNKYI
LDIGQNMAGWVRFRVKGQAGDSIRLRFAESLQSNGELYTRNFRDARSTDVYVVSGRETKD
ATWAPRFIYHGFRYVEVSGYPNAKAEDFVAEVVEDEMEHTGTFNCSDETLNKIIRNAFWG
IRSNYKGMPVDCPQRNERQPWLGDRTMGCWGESMLFDNYAMYTKWTRDIREAQREDGCIP
DVAPAYWNYYSDNVTWPAALPMACDMLFTNFGDKRPIEENYPAIKKWVSHIREYYMTEEY
IITKDKYGDWCVPPESLELIHSKDPSRKTDGDLIATAYYLKVLQLMHRFASLQGLEADAK
EWEDLEHRMKDAFNARFLHVKESTSLVPGHALYPDSIFYGNNTVTANILPLAFGLVPKNQ
INAVAQNAVASIITTNKGHISTGVIGVQWLLRELSRRGHADVAYLLATNKTYPSWGYMVE
KGATTIWELWNGDTANPEMNSGNHVMLLGDLLPWCFNNLAGIRADRWKSGYKHIVFQPAF
EIQELSNVDASYMSIYGKITSRWAKTPTHLEWDIELPANTTGEVHLPDGRKENIGSGKYH
FSVDIPTRNTAILSDEFLYEKASFPECHGATIVELKNGDLVASFFGGTKERNPDCCIWVC
RKPKGSKEWTAPKLAADSVFLLKDSQAALAGIDSTCTPVKDEKGKLIARRKACWNPVLFQ
IPGGDLILFYKIGLKVSDWTGWLVRSRDGGKTWSKREPLPEGFLGPIKNKPEYINGRIIC
PSSTEGSNGWRIHFEISDDKGKTWKMVGPLDAELSVPTQNRKKGGMNVDDQEGGEAIRGE
GAKPVYAIQPSILKHKDGRLQVLCRTRNAQVATAWSSDNGDTWSKVTLLDVPNNNSGTDA
VTMKDGRHILIYNNFSTLPGTPKGPRTPLCVAVSEDGINWKPVLTLEDSPISQYSYPSII
QGKDGKLHAIYTWRRQRIKYAEIDPTKF

Enzyme Prediction     

No EC number prediction in MGYG000000013_03445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	357	886	5.7e-165	0.9861111111111112
CBM67	142	327	1.1e-38	0.9488636363636364
GH33	920	1271	1.4e-37	0.9093567251461988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.00e-148	458	819	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam13088	BNR_2	4.65e-99	938	1268	1	279	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam08531	Bac_rhamnosid_N	3.57e-77	174	345	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
cd15482	Sialidase_non-viral	7.06e-47	917	1284	4	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam05592	Bac_rhamnosid	5.60e-40	352	453	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL37629.1	0.0	1	1288	1	1288
QDH55645.1	0.0	1	1288	1	1286
QUT29077.1	0.0	1	1288	1	1286
QUR43127.1	0.0	1	1288	1	1286
QUT23583.1	0.0	1	1288	1	1286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.93e-190	28	887	34	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	8.22e-140	22	894	2	1002	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.71e-110	23	903	1	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
4X6K_A	7.67e-07	1046	1283	240	471	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Siastatin B [[Ruminococcus] gnavus CC55_001C]
4X47_A	7.71e-07	1046	1283	243	474	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Neu5Ac2en [[Ruminococcus] gnavus ATCC 29149],4X49_A Crystal structure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with oseltamivir carboxylate [[Ruminococcus] gnavus ATCC 29149],4X4A_A Crystal structure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with 2,7-Anhydro-Neu5Ac [[Ruminococcus] gnavus ATCC 29149]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.24e-143	31	902	41	894	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	6.54e-143	2	894	4	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	3.31e-139	22	894	2	1002	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.40e-133	32	887	38	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	4.65e-16	272	888	513	1138	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000465	0.998770	0.000180	0.000218	0.000179	0.000157

TMHMM  Annotations     

start	end
5	27