CAZyme Information: MGYG000000013_03449

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_03449
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	MGYG000000013_8|CGC3	49294.91	7.912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 293289; End: 294623 Strand: -

Full Sequence      

MNLRTILLVFLCFCATTVLRAERVDMLKAGAKANGKALNTKLINSTIDRLNRGGGGTLFF
PAGTYLTGSIHLKSNITLELEAGATLLFSDNFDDYLPFVEVRHEGVMMKSFQPLIYAVDA
ENITIKGEGTLDGQGKKWWMEFFRVMIDLKDNGMRDINKYQPMWDAANDTTAIYAETNKD
YVTTLQRRFFRPPFIQPVRCKKVKIEGVKIINSPFWTVNPEFCDNVTIKGITIDNAPSPN
TDGVNPESCRNVHISDCHISVGDDCITIKSGRDAQARRLGVPCENITITNCTMLSGHGGV
VIGSEMSGSVRKVTISNCVFDGTDRGIRIKSTRGRGGVVEDIRVSNVVMSNIKQEAVVLN
LKYSKMPAEPKSERTPIFRNVHISGMTVTDVKTPIKMVGLEEAPISDIVLRDIHIQGGKQ
KCIFENCERITMDDVIVNGEEIKM

Enzyme Prediction     

No EC number prediction in MGYG000000013_03449.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	53	421	6.3e-96	0.92

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	9.38e-95	24	358	83	404	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	3.47e-42	61	426	12	314	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	2.48e-29	13	426	57	419	polygalacturonase ADPG
PLN02188	PLN02188	4.89e-28	1	416	1	375	polygalacturonase/glycoside hydrolase family protein
PLN02793	PLN02793	6.78e-24	123	415	145	394	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL37625.1	0.0	1	444	1	444
QRN01960.1	0.0	1	443	1	443
QUT29073.1	0.0	1	443	1	443
QUT23579.1	0.0	1	443	1	443
QUR43133.1	5.62e-317	1	443	1	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	4.17e-86	22	443	26	437	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	3.92e-64	30	441	51	452	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	2.21e-26	15	388	148	529	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	4.96e-23	65	365	52	316	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	7.11e-14	30	134	28	122	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.21e-48	20	415	59	424	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	1.65e-36	198	392	28	231	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P15922	1.60e-25	16	364	144	495	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
Q8RY29	3.77e-24	30	426	74	419	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2
P18192	5.00e-24	28	365	36	342	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999180	0.000163	0.000144	0.000140	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_03449.