CAZyme Information: MGYG000000013_03484

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_03484
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	MGYG000000013_9|CGC1	58558.74	4.8029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 14302; End: 15864 Strand: +

Full Sequence      

MKKIYSLLFVSLFLFLGYSCDDGSLSHSDVYIPDPVEETDEDDGFSAEPTTEAVIKMQFG
DGHEHQIIDGFGCAFAEWSHRIWNNMMREDVVDDLFGENGLKLNIFRGEVFPHYQNPVTN
VIDFGINRTFNLAANDPSMINDYWRDFNGSGCGEQVQLGQMWLVDILQRKYKNVKFMFST
WSPPGTMKSNGKPSGGSLKSGSEDAFADYLIDFIKAYTEKFGIKIYAISPSNEPNSSGTG
WNGCSWSYTNLANFCQDNLRPALDKAGYQDMKIIFGEHSWWKAGVTFLENGLKARPELAN
SNIIAAAHGYTLIGNTEFVQSPLCAENNIHIWNTETSSTDTYDPSWKNAMQWATTFHNYL
AVSNLNAFVWWAGARPCTNNEALIRLEEALPGTNYERAARYYSYGQFTKFIPEGSRRVDV
KTIAPENGEEVFPKELLMTAYVKDDTYTIVLVNNSTSKAFETKLEIEGKEFQTMISYTSD
EGVKWQRKKVNPSLSGLRAITVPKFSVVTITGKMKDIGAE

Enzyme Prediction     

No EC number prediction in MGYG000000013_03484.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	57	510	3.7e-206	0.9955555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	3.14e-22	63	509	42	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam14587	Glyco_hydr_30_2	2.34e-08	157	384	103	366	O-Glycosyl hydrolase family 30.
pfam02057	Glyco_hydro_59	1.63e-07	173	372	89	252	Glycosyl hydrolase family 59.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73128.1	0.0	1	520	1	520
ALJ39695.1	0.0	1	520	1	520
QMW85450.1	0.0	1	520	1	520
AAO78132.1	0.0	1	520	1	520
QQA08798.1	0.0	1	520	1	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CXP_A	1.58e-14	64	509	13	384	X-raycrystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, Xyn30A, from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
7O0E_A	6.76e-14	65	510	13	445	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	3.09e-13	65	510	20	452	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
1NOF_A	4.83e-13	175	513	77	383	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]
2WNW_A	3.27e-10	63	278	40	240	Thecrystal structure of SrfJ from salmonella typhimurium [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],2WNW_B The crystal structure of SrfJ from salmonella typhimurium [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	7.34e-14	65	510	37	469	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
P17439	4.80e-09	96	458	128	484	Lysosomal acid glucosylceramidase OS=Mus musculus OX=10090 GN=Gba PE=1 SV=1
G5ECR8	2.42e-07	66	263	102	292	Putative glucosylceramidase 3 OS=Caenorhabditis elegans OX=6239 GN=gba-3 PE=3 SV=1
P04062	3.26e-07	96	458	148	505	Lysosomal acid glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA PE=1 SV=3
Q9BDT0	3.26e-07	96	458	148	505	Lysosomal acid glucosylceramidase OS=Pan troglodytes OX=9598 GN=GBA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000024	0.006841	0.993158	0.000003	0.000003	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_03484.