CAZyme Information: MGYG000000013_03548

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_03548
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000013_9|CGC6	42888.02	8.3996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 131713; End: 132834 Strand: -

Full Sequence      

MKRRLFFVVTLLAGWNLLSGQSLPDRKETLKTLVKVNDCFMKKYADYTQPSYVGKFRPSN
IWTRGVYYEGLMALHTIYPRSDYYDYAYDWADFHKWGLRDGNTTRNADDHCCGQTYIELY
KICPDPVKIKNIKAAMDMLVNTPQVDDWTWIDAIQMGMPVLAQLGKVTGEQKYYDKMWQM
YACSRNKIGKGLFNEKEGLWWRDANFVPPYKEPNGKNCYWSRGNGWVYTALVRVLNEIPM
DEVHRADYKADFLAMSKALKACQRTDGFWNVSLHDESNYGGKETSGTTLFIYGMAWGVRN
GLLDKKEYMPVIVKAWNAVVKEAVRSNGSLGYVQGSGKEPKDSQPVTYKSVPDFEDYGVG
CFLLAGTEVYKLD

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	371	1.5e-89	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.31e-107	34	372	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.50e-44	40	372	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72529.1	1.79e-267	1	373	1	373
QRQ54634.1	5.02e-256	1	373	1	374
SCV07133.1	5.02e-256	1	373	1	374
ALJ47735.1	5.02e-256	1	373	1	374
QDO69334.1	5.13e-224	1	373	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q88_A	8.22e-67	25	368	8	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
5NOA_A	2.12e-66	60	368	54	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4CE7_A	3.13e-42	20	372	7	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
3K11_A	1.52e-14	141	372	192	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	5.56e-48	62	373	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	3.75e-42	1	372	1	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	3.06e-37	46	369	76	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999131	0.000188	0.000150	0.000137	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_03548.