CAZyme Information: MGYG000000013_03937

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_03937
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		39883.53	6.8177

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 232502; End: 233518 Strand: -

Full Sequence      

MEEKLFSICIPSYNRPAEIRRLLNSIDTTHVDEVEIVICEDKSPKREEIRKQVLDFKSKT
RYEVNYIENEENCGYDKNLRNLIRVAKGHFIMFMGDDDLFMPGAFDKFFDFAKEHSDCGY
ILRSYRNNFANGDHEDFRYYSEDRVFPPCKETYIDLFGKSVFVSGFTIRRDCALEFESEK
FDSSLLYQMYLLAETCYKYPAAYSRVIITQAIEGGTPFFGSSESEKAIYTPGTITIDNSI
NFMAWYIKLQDYIAKEHNDDSNKILMLNQSKYSYPVLEIQRNKGIKVFREYARRLKEMGY
AQSFYFYIYYYALIVLGAKNCRFIIKTLKHIIGHRPQL

Enzyme Prediction     

No EC number prediction in MGYG000000013_03937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	165	1.8e-19	0.9176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	4.82e-16	7	171	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.21e-10	8	146	1	143	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04186	GT_2_like_c	1.53e-10	8	143	1	140	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	6.90e-09	4	296	3	285	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
PRK10018	PRK10018	5.34e-07	2	109	3	107	colanic acid biosynthesis glycosyltransferase WcaA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA50507.1	1.51e-177	1	338	1	338
VEJ19450.1	2.47e-143	1	338	1	338
SMD28990.1	2.47e-143	1	338	1	338
ATA70427.1	3.93e-135	1	338	1	338
VEI54093.1	5.58e-135	1	338	1	338

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48214	1.26e-08	5	142	1	128	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
298	317