CAZyme Information: MGYG000000013_04064

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_04064
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1003		111780.85	9.2586

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 142632; End: 145643 Strand: +

Full Sequence      

MKIIPSIVTFLFFIAAGTVSSPAQNATTVEPLLVYKALQDKDCRHWVDSVMDKLSFKEKV
GQLFIYTIAPVDTKRNLELLREVIDTYKVGGLLFSGGKMQNQVELTNRAQRQAKVPLMIT
FDGEWGLAMRLRGMPVFPRNMVLGCIRDNRLLYEYGREVARQCRQIGVQVNFAPVADVNI
NPKNPVINTRSFGEDPIQVADKVIAYASGLESGGVLSVCKHFPGHGDTDVDSHKALPVLP
FTRERLDSVELYPFKEAIRAGLGGMMVGHLQVPVIEPIGGLPSSLSRNVVYDLLTDELAF
KGLIFTDALAMKGVAGNGNVSLQALKAGNDMVLSPRNLKEEIPAVLEAIEKGELTREDIE
SKCRKVLTYKYVLGLKKKSYVQLSGLEQRINSPQTRDLVRRLNLAAVTVLNNKNHILPLH
TDKEQTIALLEVGDPGETDALAKQLSRYTFLARFSLRANQPEGVNQRLRDSLSAYKRIIV
AVSEQRLASYQSFFAKFVPESPVIYLFFTPGKMMLQIQRAVAHASAVVLGHSYNSDVQRQ
VADVLFAKASADGQLSASLGELFPTGAGVTITPKTPLHFVPEEYGLSSVHLKRIDSIALD
GVRQGAYPGCQVVVLKNGHIMFDKAFGTYTGKGSPRVESTSIYDLASLSKTTGTLLAIMK
LYDKGRFNLTDKISDHLPFLQRTDKKDITIQEILYHQSGLPSWIPFYQEAIDKDSYDGRL
FSARKDAHHPLRLGTTSWANPKFKFKSEYVSSVKTGDYIVQICDSLWLNRSFRKVIEEKI
AEAPLKQKRYVYSDVGFILLGMLVEQLAGMPMEVYLQREFYEPMGLEHTGYLPLRRFAKS
EIVPSNKDLFLRKEILQGFVHDEASAFFGGLAGNAGLFSTARDVARVYQMLLNGGEIDGQ
RYLSKETCQLFTTETSKISRRGLGFDKPDADDPKKGNCAPAAPAEVYGHTGFTGTCAWVD
PVNELVYVFLSNRIYPDVTNRKLNQLHIRERIQGAIYDAMKKK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	109	333	4.2e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	8.01e-75	57	430	4	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.96e-74	58	368	4	315	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	4.65e-61	581	1001	30	432	putative periplasmic esterase; Provisional
COG1680	AmpC	4.13e-45	556	977	1	367	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].
pfam00144	Beta-lactamase	2.57e-43	594	986	1	321	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT79868.1	0.0	1	1003	1	1003
ALJ47263.1	0.0	1	1003	1	1003
SCV06667.1	0.0	1	1003	1	1003
QRQ58738.1	0.0	1	1003	1	1003
QDM09839.1	0.0	1	1003	1	1003

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	2.10e-60	54	439	11	404	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	9.25e-58	48	430	36	458	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.70e-57	48	430	10	432	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.71e-57	48	430	40	462	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	2.17e-47	61	359	31	335	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	5.07e-57	48	430	36	458	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	9.31e-48	80	471	55	479	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
O05213	5.01e-44	561	984	22	415	N-acetylmuramyl-L-alanine amidase OS=Bacillus subtilis (strain 168) OX=224308 GN=amiE PE=1 SV=3
B5RCU8	1.89e-43	581	984	30	406	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=yfeW PE=3 SV=1
Q5PCQ2	3.46e-43	581	984	30	406	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.018571	0.979559	0.000587	0.000426	0.000383	0.000433

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_04064.