CAZyme Information: MGYG000000013_04535

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_04535
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MGYG000000013_15|CGC2	69125.17	8.3926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 41221; End: 43032 Strand: +

Full Sequence      

MKKKKWICLLLSALLGVGTAFPQQSKESPVEKVKKIGDKLIRETPFAYKLGLASRSTSFN
ALNFVDFGRTFGLGQEAVAYAYTQLSFPRDTTIRVETEHNDACKIWCNGQLVYENKGKRD
IKINRGERSMQMTSSFLLPLKSGNNNVLIKSATFGKEWCVFLQPPSDNDAVLSIVRSYPQ
IGLTNLNNVDKQVSNLTNWLIIGPFRGGIDVVHEPEQEFKFGYMYKGLHCPVTWTIPKIE
VLGEMIDPEVWGTTYQWNYHNGGVAWAMQQLGELTGADKYTKWATDFCDYQMEGMPFVDY
QVNNLRAYNSANAMVINSTLLDFTLAPSLPILYRLRTDKDFKNRNIYQAYIDKMTNYARF
GQIRSEGMTNYTRDTPEKYTVWVDDMFMGIPFLIQAGLYSNSPELRKIFFDDAANQIIDF
TKHVWNKDTRLYMHANYTSRPGIKLPHWSRANGWAIWAMSDVLMALPKSHPKYKAILKQY
QTFVYSLIKYQSPDGFWHNVIDRSDSPKEVSGTAIFTMGIARGIRYGWLDKKKFIPIALK
GWDAVASEIEDDGTVHKICIGTMCTEDVNYYMNRPFFDDDTHGSFAVIFAGIEVQRMMDE
YAK

Enzyme Prediction     

No EC number prediction in MGYG000000013_04535.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	253	596	1.1e-72	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.56e-57	256	597	26	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.74e-44	246	596	23	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH84099.1	0.0	1	603	1	599
QJB38492.1	0.0	13	599	15	597
QJB32015.1	0.0	13	599	15	597
ACU05305.1	1.47e-86	14	597	17	573
AXY74235.1	2.15e-66	7	597	12	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.07e-39	251	599	84	415	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	3.90e-26	256	603	38	373	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.52e-25	256	603	28	363	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.08e-15	364	555	139	335	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4CE7_A	4.21e-15	369	597	141	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.14e-25	256	603	38	373	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	2.44e-14	369	597	148	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000621	0.998240	0.000577	0.000184	0.000178	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_04535.