CAZyme Information: MGYG000000013_04562

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_04562
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000000013_15|CGC3	44976.95	5.2762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 94441; End: 95622 Strand: +

Full Sequence      

MRILLLSILGLLTLASCSRQEPMEVLIDRVFTVAEQQYTNMDTRLTEKTLPRTLSAEGEF
VPSNIYWWCSGFYPGSLWYIYEYTRNDAVKALAEKNTLKLDSIQYVTRDHDVGFQLNCSY
GNAFRLTGNEAYKQVLYQGAKSLSTRFQPTAGVIRSWDFVRKGCDWKFPVIIDNMMNLEL
LLSMSKAYADDSLQNIACTHANTTILNHFRDDYSTYHLVDYDPETGEVRGKQTVQGFSDN
SSWSRGQAWALYSYTMMFRLTGYQNYLLQAGHIADMLLRRLPADGIPYWDFDAPVEEHSY
RDASAAAIMASAFIELSRYIPGTEAKESYLAMAEKQLRTLASKEYLAEPDTNGNFLLKHS
VGALPDKSEVDVPLTYADYYFLEALLRYKNLQK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	64	388	3.1e-127	0.9848024316109423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.98e-08	58	388	19	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40061.1	4.25e-292	1	393	1	393
QUT26394.1	1.83e-277	1	393	1	393
QGT72632.1	4.30e-276	1	393	1	393
SCV07260.1	1.75e-275	1	393	1	393
QRQ54741.1	1.75e-275	1	393	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	7.98e-105	37	393	42	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	6.99e-49	35	388	37	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	7.15e-49	35	388	38	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.00e-48	35	388	38	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	3.82e-48	35	388	38	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.11e-95	36	391	36	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9A0T3	5.34e-49	35	388	39	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	3.91e-48	35	388	38	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	2.92e-46	68	388	67	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	4.05e-44	51	387	25	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000004	0.002989	0.997047	0.000001	0.000002	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_04562.