CAZyme Information: MGYG000000014_00605

Basic Information

• Species: Clostridium butyricum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium butyricum
• CAZyme ID: MGYG000000014_00605
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		51814.71	4.8085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000014	4564499	Isolate	United Kingdom	Europe

• Gene Location: Start: 641846; End: 643258 Strand: +

Full Sequence      

MCKIFKTFKKALIAGAIVMAQTIAFMMPMPITAYAASSNGFQVSGTKLYDANGKEFVMRG
INHAHAWYKGQESTAIPAIAKTGANTVRVALGDGDQWGYDDINTVKNIISLCEKNNLVAV
LEVHDATGSDDYSKLDNAVNYWISMKDALKGKESTVILNIVNEWYGTWDGQKWAEGYEKA
IPKLRAAGIDNTIMVDSAGWGQYPKSIADYGKAVFNSDPDKNTMFSIHMYEYAGGDANTV
KTNIDSVINQNLALCIGEFGIRHTNGDVDEETIMNYCQEKSVGYIGWSWYGNGTDWIYLD
IANDWSGNSLTEWGNKLLNYKNGIKNTSKICSVFNGSTGGSDQGTSGNKITVEAEDGYLN
GVQKSTERSGYSGSGYVTGFDNNSDYIELNVNVPSSGTYYLNVQYASQYGDKYTKLIVNN
SDHGDKLLKQSTKFIDGYLDEISLNSGDNKIKLQNDWGYYDIDNITVTKK

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	295	9.6e-97	0.9841897233201581
CBM35	353	467	2e-30	0.9831932773109243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04086	CBM35_mannanase-like	1.03e-45	350	468	1	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
pfam00150	Cellulase	3.25e-35	49	293	1	272	Cellulase (glycosyl hydrolase family 5).
pfam16990	CBM_35	7.77e-25	353	467	3	117	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
cd04083	CBM35_Lmo2446-like	8.60e-14	351	467	2	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd02795	CBM6-CBM35-CBM36_like	1.53e-09	351	410	1	60	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU43361.1	0.0	1	470	1	470
QGH23260.1	0.0	1	470	1	470
QCJ05579.1	0.0	1	470	1	470
BBK77741.1	0.0	1	470	1	470
QSX02130.1	0.0	1	470	1	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WKY_A	1.12e-153	35	346	4	313	Crystalstructure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module [Bacillus sp. JAMB-602]
3JUG_A	5.31e-150	37	337	21	321	Crystalstructure of endo-beta-1,4-mannanase from the alkaliphilic Bacillus sp. N16-5 [Bacillus sp. N16-5]
2WHJ_A	6.69e-149	40	340	2	302	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
2WHL_A	7.16e-145	40	334	1	293	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
1BQC_A	6.69e-80	38	334	1	301	Beta-MannanaseFrom Thermomonospora Fusca [Thermobifida fusca],2MAN_A Mannotriose Complex Of Thermomonospora Fusca Beta-Mannanase [Thermobifida fusca],3MAN_A Mannohexaose Complex Of Thermomonospora Fusca Beta-mannanase [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1K3N4	3.66e-148	40	340	2	302	Mannan endo-1,4-beta-mannosidase OS=Salipaludibacillus agaradhaerens OX=76935 PE=1 SV=1
P51529	1.20e-77	36	348	35	348	Mannan endo-1,4-beta-mannosidase OS=Streptomyces lividans OX=1916 GN=manA PE=1 SV=2
B3PF24	1.39e-75	33	383	41	384	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=man5A PE=1 SV=1
P22533	5.75e-56	60	314	55	313	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2
G2Q4H7	5.87e-18	351	468	43	160	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.999056	0.000157	0.000196	0.000156	0.000139

TMHMM  Annotations     

start	end
12	34