CAZyme Information: MGYG000000014_02403

Basic Information

• Species: Clostridium butyricum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium butyricum
• CAZyme ID: MGYG000000014_02403
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000000014_9|CGC7	39797.85	4.4947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000014	4564499	Isolate	United Kingdom	Europe

• Gene Location: Start: 133724; End: 134755 Strand: +

Full Sequence      

MKNKQKYMLMFSLIASIFIFLGCTANKDVNNETISENRNNIFDESIGKISAWAAYWNLDV
DEEVSTLGSQLGSVSYFEAYFDNKYEIIIPDELLKYFNETKSENYEKYITFVNDVKKDDN
KFSLKDINLLKEILSDSELQNKYVNDITSIAINNGFDGIEIDFEGIKNNIELWDKYIEFI
NKLYYYCEKSNLKLRIILEPNTPIENINFGEGPVYVMMCYNLHGSSTKPGEKANPEFIND
LIDKMEKVPGTKEFAVASGGFDWDENGKTTSVDEKKAEELLEKYNSEKKRDSTSGCIYFE
YIDESNIKHEVWYADKDTLNKWMKVISERGHIVSLWRLGGNKF

Enzyme Prediction     

No EC number prediction in MGYG000000014_02403.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.72e-31	53	339	5	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
cd06549	GH18_trifunctional	4.50e-24	90	340	45	292	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
COG3858	YaaH	5.82e-16	133	339	185	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	2.18e-06	77	340	30	298	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.45e-04	74	229	29	193	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB83895.1	1.56e-255	1	343	1	343
QMW89963.1	9.01e-255	1	343	1	343
BBK77964.1	9.01e-255	1	343	1	343
QGH23454.1	8.64e-253	1	343	1	343
QGH27498.1	8.64e-253	1	343	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	5.23e-09	128	339	184	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	1.64e-07	131	339	188	413	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DPJ9	2.14e-08	128	339	183	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
O05495	4.96e-08	129	338	177	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
Q9K3E4	5.06e-08	128	339	183	410	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	1.60e-07	133	339	186	409	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000065	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24