CAZyme Information: MGYG000000014_02757

Basic Information

• Species: Clostridium butyricum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium butyricum
• CAZyme ID: MGYG000000014_02757
• CAZy Family: GH31
• CAZyme Description: Oligosaccharide 4-alpha-D-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796		92966.79	4.7905

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000014	4564499	Isolate	United Kingdom	Europe

• Gene Location: Start: 23691; End: 26081 Strand: +

Full Sequence      

MNLCKGKHEVFGKIKNYEVDGNKVIIKYENIDAIISIISDDIINFFVPLFRKERISKAVE
NIELLKDDELNFDIKEFEGKIQITTNKLIVKVHDEFIVDIYDSNETLLCSDYREKCDPFK
RRYGDYQLAEAEGHSTSRDSEYKVYVAKNMEEDMYFYGFGEKTGHLNKKGYHYVNWNTDN
PAPHGETFDRLYQSVPFFIGLKKDNAFGIFFDNHFETHFDMGRDNSKYYYFSAVDGNLDY
YFIYGPSIKNVVSGYTTLTGTMPMPQKWTLGYQQCRWSYDNEERVMEIAENFRKRDIPCD
TIYLDIDYMDGYRVFTWDNERFKNPEDMIKKLKEMGFKVVTIIDPGVKVDKNYKIYKEGL
ENKYFATDKNDITYVNEVWPGDAVYPDFLNSNVREWWADNQKIMMDAGVSGIWNDMNEPA
SFRGPLPDDVMFNNDGIPVEHREAHNVYGHFMAKATYEGIKSSINKRPFIVTRAGYAGTQ
KYSTVWTGDNQSTWEHLRMSVPMLMNMGLSGMTFCGTDVGGFGHDCSAELLSRWVQVGAF
TPLFRNHAAMGTRDQEPWAFDKETEDINRKYIKLRYKLIPYMYDTMWKCSNSGSPFLKPL
LFDYQNDKNTYEINDQFICGDNILVAPVLEQGAKCRMVYLPEGNTWIDYWTKEEFKGGQY
IIKNTPLDVCPIFIKGGTIIPICEEQNYIGEKELNKLTMELYLSSDKTNSTYNHYIDDGE
SFKYENGEYNIYEINVEENDNINISINILNNKFNDNYDSIEIMFINWSGKDVFINNEKIK
VDNNRILINKSKLNCD

Enzyme Prediction     

EC	3.2.1.84

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	240	680	9.3e-180	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	61	737	66	725	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06603	GH31_GANC_GANAB_alpha	0.0	260	721	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06604	GH31_glucosidase_II_MalA	0.0	260	593	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
pfam01055	Glyco_hydro_31	0.0	241	680	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PLN02763	PLN02763	2.06e-153	156	729	76	643	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU45499.1	0.0	1	796	1	796
QGH25301.1	0.0	1	796	1	796
QUF83832.1	0.0	1	796	1	796
QCJ06725.1	0.0	1	796	1	796
QGH21263.1	0.0	1	796	1	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JR6_A	6.08e-146	7	725	26	733	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	9.30e-145	7	725	26	733	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
5DJW_A	2.18e-136	143	769	51	668	Crystalstructure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5DJW_B Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6C9X_A	3.09e-121	150	728	47	659	ChainA, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6C9X_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]
6CA1_A	6.09e-121	150	728	47	659	ChainA, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6CA1_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	3.08e-212	58	741	45	733	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
B9F676	2.54e-125	191	729	273	826	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
Q9FN05	2.22e-122	179	729	263	828	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
Q9BE70	8.50e-122	186	724	112	678	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2
Q8TET4	1.06e-120	186	724	257	823	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000014_02757.