CAZyme Information: MGYG000000014_03662

Basic Information

• Species: Clostridium butyricum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium butyricum
• CAZyme ID: MGYG000000014_03662
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	MGYG000000014_24|CGC1	54185.33	5.9978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000014	4564499	Isolate	United Kingdom	Europe

• Gene Location: Start: 43266; End: 44672 Strand: +

Full Sequence      

MKFANDFLFGAASAAYQVEGAWDKDGKGISNWDVFSKIPGKTFEGTNGDVAVDHYNRYKE
DIKLMAEMGLESYRFSVSWPRIIPDGDGEINKKGLQFYNNLINECLKYGIVPFVTLYHWD
MPQVLEEQGGWTNKRTINGFVKYAEACFKAFGDRVKHWITFNEAIVFCKSGYITGAHPPG
LVNDQKKYFQATHNVFVAHAKCVEIYKNLKQYGEIGITHVFNPAYSFDNKEENIAATEHA
NYYDTYWYYDPILKGEYPEYVVELLKEKNLVPDWTNEELELLKNTADKNDFIGLNYYQPQ
RIMKNTDGQQLVASRENSTGAPGNPSFDGFYKTVMMEDKVYTKWGWEISPQGFLDGLRML
KARYGDVKLYITENGLGDEDPIIEDEIVDIPRIKFIEEHLKVVKAAISEGINLKGYYAWS
VIDLLSWLNGYKKQYGFIYVDHKNNYDRKKKLSFHWYKKVIETRGENL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.85	3.2.1.21	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	465	7.7e-169	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	1	466	2	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	0.0	3	466	5	453	Glycosyl hydrolase family 1.
TIGR03356	BGL	1.95e-177	6	457	3	426	beta-galactosidase.
PRK13511	PRK13511	7.32e-146	2	464	4	466	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	6.23e-109	3	457	28	476	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSX02782.1	0.0	1	468	1	468
QGH27989.1	0.0	1	468	1	468
QJU45993.1	0.0	1	468	1	468
QGH23944.1	0.0	1	468	1	468
QCJ06233.1	0.0	1	468	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YHS_A	2.10e-285	1	468	1	469	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)],5YHS_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)]
5YIF_A	1.72e-284	1	468	1	469	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)],5YIF_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)]
6Z1H_A	5.45e-155	1	468	9	452	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
7M1R_A	2.17e-149	3	468	11	480	ChainA, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_B Chain B, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_C Chain C, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_D Chain D, 6-phospho-beta-galactosidase [Bacillus licheniformis]
4ZE4_A	2.06e-148	3	468	16	485	Structureof Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4ZE4_B Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4ZEN_A Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],4ZEN_B Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],4ZEP_A Structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-glucose [Geobacillus stearothermophilus],4ZEP_B Structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-glucose [Geobacillus stearothermophilus],5OKB_A High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKB_B High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKB_C High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKB_D High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKH_A Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in the C2 spacegroup [Geobacillus stearothermophilus],5OKH_B Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in the C2 spacegroup [Geobacillus stearothermophilus],5OKJ_A Non-conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in the C2 spacegroup [Geobacillus stearothermophilus],5OKJ_B Non-conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in the C2 spacegroup [Geobacillus stearothermophilus],5OKK_A Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],5OKK_B Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],5OKQ_A Non-conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],5OKQ_B Non-conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],5OKR_A Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose [Geobacillus stearothermophilus],5OKR_B Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose [Geobacillus stearothermophilus],5OKS_A Non-conservatively refined structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose [Geobacillus stearothermophilus],5OKS_B Non-conservatively refined structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42403	3.67e-144	2	468	8	477	Aryl-phospho-beta-D-glucosidase BglC OS=Bacillus subtilis (strain 168) OX=224308 GN=bglC PE=1 SV=1
Q97EZ2	1.25e-122	2	460	3	460	6-phospho-beta-galactosidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lacG PE=3 SV=1
P26208	1.98e-120	1	465	4	447	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q08638	1.91e-117	2	465	5	443	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P22073	3.69e-115	2	463	5	441	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000014_03662.