CAZyme Information: MGYG000000015_00730

Basic Information

• Species: Enterobacter mori
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter mori
• CAZyme ID: MGYG000000015_00730
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146	MGYG000000015_1|CGC10	16533.11	8.8072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000015	4878649	Isolate	United Kingdom	Europe

• Gene Location: Start: 761905; End: 762345 Strand: -

Full Sequence      

MKKLMLLLLIISQSALANCWDKAAHYYHVDPYLLYAIANVESGMNPYAVGQNHDGTRDVG
LMQINSSHFTALESRGIDEYRLMTEPCTSIMVGASILSGMIKVYGYNWEAVGAYNAGLKK
ENYPQRMKYAHKVWAKYQQLKLAAQY

Enzyme Prediction     

No EC number prediction in MGYG000000015_00730.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	27	141	1.9e-24	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	6.10e-88	12	146	14	148	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	1.43e-50	27	139	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.15e-28	20	118	1	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	4.15e-22	18	141	21	146	lytic transglycosylase; Provisional
cd00254	LT-like	2.33e-14	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIR22239.1	2.37e-100	1	146	1	146
QGW86464.1	2.37e-100	1	146	1	146
AXM00473.1	1.95e-99	1	146	1	146
AVU49973.1	1.95e-99	1	146	1	146
QIF25729.1	1.95e-99	1	146	1	146

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	2.94e-10	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	7.50e-43	9	141	11	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	7.50e-43	9	141	11	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	3.03e-42	9	141	11	143	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	1.66e-32	6	145	7	144	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	6.66e-32	6	145	7	144	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001002	0.994933	0.003402	0.000220	0.000210	0.000214

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000015_00730.