CAZyme Information: MGYG000000019_00329

Basic Information

• Species: Enterobacter cloacae_O
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_O
• CAZyme ID: MGYG000000019_00329
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280	MGYG000000019_1|CGC6	33153.91	9.6125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000019	4947669	Isolate	United Kingdom	Europe

• Gene Location: Start: 348167; End: 349009 Strand: -

Full Sequence      

MTTQRPLISIYMPTWNRQQLAIRAIKSVLRQDYDNWELIIVDDCSSSYEQLQKFVEDLND
PRVMYTHNAINSGACAVRNQAIMQAKGQYLTGIDDDDEWTPNRLSIFLSHKAQLVTHAFL
YANDYVCQGEVYSQPASLPLYPKSPYSRRLFYKRNIIGNQVFTWAWRFKECLFDTELKAA
QDYDIFLRMVVEYGEPWKVEEATQILHINHGEMQITSSPKKFSGYFHFYRKHKDKFDRAS
RKYQLFTLYQIRNKRMNWRTLLTLLSVRNGKRLADGLRGK

Enzyme Prediction     

No EC number prediction in MGYG000000019_00329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	9	149	1.6e-27	0.8352941176470589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10018	PRK10018	0.0	2	280	1	279	colanic acid biosynthesis glycosyltransferase WcaA.
TIGR04017	WcaA	0.0	2	280	1	279	colanic acid biosynthesis glycosyl transferase WcaA. This gene is one of the glycosyl transferases involved in the biosynthesis of colanic acid, an exopolysaccharide expressed in Enterobacteraceae species.
pfam00535	Glycos_transf_2	4.01e-32	9	170	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	1.26e-28	6	210	1	195	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	7.36e-24	10	110	1	101	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWQ44152.1	1.72e-209	1	280	1	280
QEL49248.1	1.72e-209	1	280	1	280
QPO93230.1	1.72e-209	1	280	1	280
QMV78023.1	1.72e-209	1	280	1	280
AXO52073.1	1.72e-209	1	280	1	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H7L_A	1.27e-10	6	117	1	116	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]
5HEA_A	4.31e-10	7	97	6	95	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77414	6.54e-192	6	280	5	279	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
O32268	4.95e-16	1	104	1	104	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
B5L3F2	1.81e-15	7	123	5	118	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfgD OS=Escherichia coli OX=562 GN=wfgD PE=1 SV=1
Q0P9C6	1.76e-12	6	119	2	116	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1
Q48214	3.93e-12	7	201	1	194	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000019_00329.