CAZyme Information: MGYG000000019_00644

Basic Information

• Species: Enterobacter cloacae_O
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_O
• CAZyme ID: MGYG000000019_00644
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000000019_2|CGC6	39877.22	9.5118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000019	4947669	Isolate	United Kingdom	Europe

• Gene Location: Start: 279997; End: 281076 Strand: -

Full Sequence      

MMKKLLALALVAPLLVSCSSKKGDSYNEAWVKDTNGFDILMGQFAHNIENIWGFNEVLIA
GPKDYVKYTDAYQTRSHINFDDGTITVETIAGTEPAAHLRQAIIKTLLMGDDPGSIDLYS
DADDITISKEPFLYGQVVDQTGQPIRWEGRATKFADYLLQTRLKSRTNGLKVIYSVTINL
VPNHLDKRAHKYLGMVRQASRKYGVDESLILAIMQTESSFNPYAVSRSDALGLMQVVQHS
AGKDVFRSQGKSGTPSRSYLFDPQSNIDTGTAYLAMLNNVYLGGIDNPTSRRYAVITAYN
GGAGSVLRVFSNDKVQAANIINSMAPGDVYTTLTTRHPSAESRRYLYKVNTAQKNYRRR

Enzyme Prediction     

No EC number prediction in MGYG000000019_00644.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	207	354	4.8e-21	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11671	mltC	0.0	17	359	16	359	membrane-bound lytic murein transglycosylase MltC.
pfam11873	DUF3393	1.51e-99	30	191	1	161	Domain of unknown function (DUF3393). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 188 to 206 amino acids in length. This domain is found associated with pfam01464.
cd16893	LT_MltC_MltE	8.66e-98	195	354	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
COG0741	MltE	2.92e-57	47	354	1	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK15470	emtA	3.78e-45	187	352	34	199	membrane-bound lytic murein transglycosylase EmtA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLA00456.1	5.94e-261	2	359	1	358
QLA70437.1	5.94e-261	2	359	1	358
BBW32695.1	7.20e-260	1	359	1	359
BBW37459.1	7.20e-260	1	359	1	359
CBK86590.1	7.20e-260	1	359	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	2.20e-235	20	359	2	341	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	6.30e-235	20	359	2	341	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
2Y8P_A	6.04e-36	187	352	17	182	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	7.76e-36	187	352	34	199	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	1.66e-35	187	352	17	182	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4WEA0	2.57e-256	2	359	1	358	Membrane-bound lytic murein transglycosylase C OS=Enterobacter sp. (strain 638) OX=399742 GN=mltC PE=3 SV=2
C5A0N2	2.41e-243	2	359	1	359	Membrane-bound lytic murein transglycosylase C OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=mltC PE=3 SV=1
A1AFE9	2.41e-243	2	359	1	359	Membrane-bound lytic murein transglycosylase C OS=Escherichia coli O1:K1 / APEC OX=405955 GN=mltC PE=3 SV=2
B7UI10	2.41e-243	2	359	1	359	Membrane-bound lytic murein transglycosylase C OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=mltC PE=3 SV=1
B7MN10	2.41e-243	2	359	1	359	Membrane-bound lytic murein transglycosylase C OS=Escherichia coli O45:K1 (strain S88 / ExPEC) OX=585035 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000019_00644.