CAZyme Information: MGYG000000019_00766

Basic Information

• Species: Enterobacter cloacae_O
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_O
• CAZyme ID: MGYG000000019_00766
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000000019_2|CGC11	56033.3	6.7873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000019	4947669	Isolate	United Kingdom	Europe

• Gene Location: Start: 402196; End: 403623 Strand: +

Full Sequence      

MSTKQIAIPQDFMLGAAASAWQTEGWSGKKPGQDSWIDLWYKNDRHVWHNGYGPAVATDF
INRFREDVALMKQAGLTHYRTSINWSRFLTDYENATVDEEYAAYYDALFDEMHRHGIEPM
ICLEHYELPGVLLESYGGWASKHVVDLFVRYAEKVLERYHRKVTRWFTFNEPIVVQTRVY
LDALRWPYEQNTGTWMQWNHHKVLATAKVVKLFREKGYGGSVGCILNPEVTYPRSRAPHD
VRAAEKYDLFYNRVFLDPLVHGRYPAELFTLLEQHQVPWDYTADELALIANNTVDELGIN
LYYPHRVKAPSRAWHPETPFHPAYYYEPFELPGRRMNASRGWEIYPRIIYDMAMRIKNDY
RNIDWFVAESGMGVENEAQFRNRDGVIDDGYRIAFIGEHLYYALLAREEGANCRGYMLWA
FTDNVSPMNAFKNRYGLIEIDLENHRARRAKKSASWFRQLRDERVLTLRVDDEWK

Enzyme Prediction     

No EC number prediction in MGYG000000019_00766.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	461	6.3e-119	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.12e-149	9	460	5	449	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.31e-107	9	460	6	447	Glycosyl hydrolase family 1.
PRK13511	PRK13511	2.90e-85	7	466	4	468	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	1.59e-63	57	460	62	468	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.42e-56	4	460	2	469	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLA69372.1	0.0	1	475	1	475
QKZ97913.1	0.0	1	475	1	475
QPP01055.1	0.0	1	475	1	475
AJB72161.1	0.0	1	475	1	475
QPO67990.1	0.0	1	475	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	1.69e-123	6	474	1	470	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	9.85e-123	6	474	2	471	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	5.92e-115	4	460	16	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	2.36e-114	4	460	16	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	3.52e-79	2	460	5	444	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	7.18e-127	3	460	4	459	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P10482	7.73e-62	6	459	3	448	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P26208	1.79e-61	5	460	3	442	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
B3W7I3	6.50e-61	8	466	5	472	6-phospho-beta-galactosidase OS=Lacticaseibacillus casei (strain BL23) OX=543734 GN=lacG PE=3 SV=1
P14696	9.09e-61	8	466	5	472	6-phospho-beta-galactosidase OS=Lactobacillus casei OX=1582 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000019_00766.