CAZyme Information: MGYG000000019_00850

Basic Information

• Species: Enterobacter cloacae_O
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_O
• CAZyme ID: MGYG000000019_00850
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
150	MGYG000000019_3|CGC2	17332.1	9.9232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000019	4947669	Isolate	United Kingdom	Europe

• Gene Location: Start: 85620; End: 86072 Strand: +

Full Sequence      

MKRLLFLLLLLSHSAFANCWNKASQYYHIDPFLLYAIANVESGMNPRAVGINHDGTRDVG
LMQINSSHFPELERRGINEYRLMTEPCTSIMVGASILSGMIKIYGYNWEAVGAYNAGLKK
ENYPRRMVYAHKVWRKYQQLKLAARDKTNW

Enzyme Prediction     

No EC number prediction in MGYG000000019_00850.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	25	141	1.8e-22	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	2.61e-92	12	150	14	152	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	9.46e-53	27	139	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.75e-30	20	118	1	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	2.90e-26	18	141	21	146	lytic transglycosylase; Provisional
cd00254	LT-like	8.44e-15	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLA67095.1	1.31e-108	1	150	1	150
QKZ99780.1	1.86e-108	1	150	1	150
QLA60923.1	2.34e-102	1	150	1	150
ADF62327.1	2.34e-102	1	150	1	150
QCZ37936.1	6.72e-102	1	150	1	150

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	7.61e-12	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	1.14e-45	9	149	11	151	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.14e-45	9	149	11	151	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	3.26e-45	9	149	11	151	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	1.28e-35	1	149	1	148	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	2.07e-34	1	149	1	148	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003533	0.984417	0.011234	0.000274	0.000254	0.000265

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000019_00850.