CAZyme Information: MGYG000000020_00131

Basic Information

• Species: Latilactobacillus curvatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus curvatus
• CAZyme ID: MGYG000000020_00131
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		26484	6.4846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000020	1923680	Isolate	United Kingdom	Europe

• Gene Location: Start: 145906; End: 146604 Strand: -

Full Sequence      

MHCGNTCTISNEKVAILDVGGWQAEQPTEDIAISWDMQVHGWQAYFAPHIRFFMDVPETL
PELVKQRRRWTAGGIHVLLTKSMDVFRHPIKHLAMVPIIVDYSLSVIWSLFFWLSMIAFV
GVQVLCLVQGDWSRLITNFCFAAIFISIEIVVGLIQLIMASYFNDRGRSLKYIAFAPWYI
LIYWMVNTFTVAVEIGPTIIQILKGEDAGVWKSPKRSVEVVAKTKEEGNQDD

Enzyme Prediction     

No EC number prediction in MGYG000000020_00131.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	2.92e-34	13	218	218	418	N-glycosyltransferase; Provisional
PRK14583	hmsR	1.64e-25	15	221	241	442	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	1.21e-14	12	183	222	396	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	4.42e-10	15	78	171	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
pfam13632	Glyco_trans_2_3	9.00e-09	15	122	83	184	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN62721.1	5.57e-156	13	232	146	365
AZP95722.1	5.57e-156	13	232	146	365
AXN36560.1	9.18e-155	13	232	146	365
AWV73603.1	1.07e-153	13	232	146	365
QAR36186.1	1.26e-153	13	232	222	441

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XAR5	1.42e-16	4	218	225	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q8GLC5	6.01e-16	12	216	209	407	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
P75905	6.59e-16	4	218	225	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q5HCN1	8.18e-16	12	216	209	407	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q5HKQ0	8.18e-16	12	216	209	407	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
106	128
141	163
173	195