CAZyme Information: MGYG000000020_00436

Basic Information

• Species: Latilactobacillus curvatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus curvatus
• CAZyme ID: MGYG000000020_00436
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000000020_5|CGC1	33456.2	7.3193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000020	1923680	Isolate	United Kingdom	Europe

• Gene Location: Start: 5772; End: 6665 Strand: +

Full Sequence      

MESKNRNICAVLVTYNRLALLKECLAALEKNENVAHIVIVNNKSTDGTADYLATLSADKF
IIKNSDENLGGAGGFAHGMVMAYEQTDDQYFWIMDDDTIPNSDAAHQLLDKAALLKDDFG
FLCSNVRWMDGTSCNMPMPAFEWPDKINDGLVSVSQGTFVSVFLTREIVKQYGVPTQELF
IWGDDTEYTIRVSQAKSSYFVIDSVVVHKTPNNLTDITIFNDSKDRINRYFYLYRNLIYI
SKLYKGKGATIKLTIRHILYAFSTLGKAKDSRFKRAGAILKGTFTGLGFNPQIRRVD

Enzyme Prediction     

No EC number prediction in MGYG000000020_00436.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	10	113	1.5e-17	0.6058823529411764

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	1.10e-74	10	240	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.87e-36	4	260	1	267	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	2.60e-20	11	210	2	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	3.19e-19	10	240	1	236	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	2.96e-13	9	112	1	103	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV72379.1	1.95e-219	1	297	1	297
ANJ69898.1	1.95e-219	1	297	1	297
AXN35282.1	1.95e-219	1	297	1	297
BCX31018.1	3.78e-217	1	297	1	297
QEA48634.1	3.78e-217	1	297	1	297

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	2.48e-07	8	192	7	201	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000020_00436.