CAZyme Information: MGYG000000020_01889

Basic Information

• Species: Latilactobacillus curvatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus curvatus
• CAZyme ID: MGYG000000020_01889
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		35946.52	9.303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000020	1923680	Isolate	United Kingdom	Europe

• Gene Location: Start: 2302; End: 3231 Strand: -

Full Sequence      

MKKNIKDFIPFNFKYILKYIVYLNYVRGKKEIPVVKGFEETVNRIIDGGYSVSRFGDGEF
KWIFQNREEDNFEKNSPEMAKALSRAIKMDNSQLMLCVPDVFRGLEQYNKKARIYWFGAL
GKYGKDWLSLLNTDKTYYDTQFTRPYMDYIDKSDVQKKFSLLKKIWQDRDILIVEGDKTR
FGVGNDLINNAHSVTRILCPAVNAFERYQDILPEVVNYVNKMKKKPLVLISLGPTATVLS
ADLCKMDIQAIDIGHLDVEYSWSLLKAVDKIPLKNKYVNENPKEGHSVQDILDDELNKQY
TSQIVGRIK

Enzyme Prediction     

No EC number prediction in MGYG000000020_01889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	52	280	1.7e-80	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03728	glyco_access_1	2.20e-101	35	309	1	265	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
pfam08759	GT-D	1.05e-97	53	280	1	222	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE39026.1	5.93e-116	1	306	1	308
ASY47972.1	2.29e-93	16	309	9	302
QPB48224.1	3.61e-93	16	309	23	316
CAD0163093.1	2.74e-87	19	309	17	304
BBF74966.1	6.95e-85	16	309	21	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PFX_A	3.90e-53	30	308	13	276	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	3.90e-53	30	308	13	276	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	4.32e-52	30	308	13	276	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]
5V4A_A	1.81e-46	29	308	3	271	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URB1	1.85e-47	31	308	546	812	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1
Q9AEU2	8.90e-46	29	308	412	679	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999568	0.000459	0.000008	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000020_01889.