CAZyme Information: MGYG000000021_00665

Basic Information

• Species: Limosilactobacillus vaginalis_A
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus vaginalis_A
• CAZyme ID: MGYG000000021_00665
• CAZy Family: GT4
• CAZyme Description: Putative glycosyltransferase EpsF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000000021_7|CGC2	42376.52	8.9721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000021	1945993	Isolate	United Kingdom	Europe

• Gene Location: Start: 48649; End: 49752 Strand: -

Full Sequence      

MKKVLVVGDFISGSGLTQVIFNVFSRFDPVKYKIDAVGYGTDPENLTDKECEKLGWMFER
VIPVTKNPIEHWKWWKAFFKKHHYDIVYFNYSSSWNYLPVIYAKRYGKVKKVVCHSHNSY
FSHEFSNKLLMRILVAVNNHGKRIFNKYSDQKIATSKEAARWMFNEDDDVFISINGIDIP
KFSFSTESRESIRHKLKIDTKTKLVGFVGVLQDRKNPLFALEVFANYHKSNPNSVFLMLG
KGSLKEQINEKIQSLGIRDSVIQYDFIADVNKWYSAMDALLFPSMYEGLSLVALESQISN
LQILASDTNVEDIFATSNIKKMHGLDAARWASELEDSLSQSKSRDYLDSNLEKFSVARQA
EDIEKLM

Enzyme Prediction     

No EC number prediction in MGYG000000021_00665.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	195	308	3.1e-20	0.71875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03812	GT4_CapH-like	9.38e-65	3	366	1	352	capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).
cd03811	GT4_GT28_WabH-like	1.91e-30	3	308	1	294	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	1.29e-28	3	366	1	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.56e-25	1	366	2	373	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03807	GT4_WbnK-like	7.82e-25	76	307	72	295	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFS34609.1	3.06e-162	1	367	1	368
QFG72958.1	5.27e-153	1	367	1	369
AAS08850.1	1.35e-134	2	367	4	369
QLL68366.1	1.91e-134	2	367	4	369
QTQ39318.1	2.20e-133	2	367	4	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJJ_A	9.25e-07	201	296	182	276	Structureof a glycosyltransferase / state 2 [Campylobacter jejuni],6EJJ_B Structure of a glycosyltransferase / state 2 [Campylobacter jejuni]
6EJI_A	1.23e-06	201	296	182	276	Structureof a glycosyltransferase [Campylobacter jejuni],6EJI_B Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_A Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_B Structure of a glycosyltransferase [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71055	2.86e-16	2	315	6	317	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
Q04975	7.47e-09	156	306	350	502	Vi polysaccharide biosynthesis protein VipC/TviE OS=Salmonella typhi OX=90370 GN=vipC PE=4 SV=2
Q59002	4.08e-08	140	306	139	313	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
B1VEI4	3.27e-07	176	344	196	376	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) OX=504474 GN=mshA PE=3 SV=1
Q4JSW2	4.30e-07	176	366	196	402	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) OX=306537 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000021_00665.