CAZyme Information: MGYG000000021_01176

Basic Information

• Species: Limosilactobacillus vaginalis_A
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus vaginalis_A
• CAZyme ID: MGYG000000021_01176
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000000021_12|CGC1	39506.67	10.0474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000021	1945993	Isolate	United Kingdom	Europe

• Gene Location: Start: 44145; End: 45200 Strand: -

Full Sequence      

MNDKVILGTVVMLVSLNTALPGLANQQDDARNAAEIAVINQELVDVRVLRSHGDEYTREF
LLQFHNATQKYCQAFQLGVADQEKGRIRAFSDHVEQAAYQRGIEEAKTRVQVKTGLKENT
LSDQPVDQKKYLPKQPLPNQARFINQIADDARQIGKDYDLYPSIIIAQAALESSWGTSEL
SLAPHHNLFGVKGKYNGRGVLKPTTEFVGSQSTQIQDVFRSYTSNKQSLQDYAKTLQQPL
YREVHRSVTKSYREATHALVGRYATDPGYDKKLNQIIDSYRLTRYDDPKKDGNDQAQTMN
RQQLRMPRKPHLRNTHQRTISKHKKFSPVVSVIGGAASAGAITGLKKLLVS

Enzyme Prediction     

No EC number prediction in MGYG000000021_01176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	148	282	1.6e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.50e-57	139	298	42	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	5.68e-52	143	289	323	475	amidase domain-containing protein.
PRK06347	PRK06347	5.00e-43	143	300	153	317	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	4.90e-31	143	286	11	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	1.82e-23	119	277	122	294	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFS34532.1	6.71e-213	1	351	1	351
QZN92542.1	1.11e-76	1	347	1	359
QFV01117.1	1.49e-75	1	349	3	380
AXX74928.1	2.07e-66	1	349	8	338
QWS03586.1	3.33e-65	1	349	8	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	8.32e-39	140	286	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.29e-33	142	287	62	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.31e-12	143	277	6	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.78e-12	143	277	6	145	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.69e-12	143	282	4	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	3.05e-34	136	300	176	347	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	3.88e-33	139	288	61	216	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
A2RHZ5	6.80e-33	143	293	65	221	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	6.55e-32	143	293	65	221	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q2G222	6.95e-32	142	287	322	473	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000312	0.998992	0.000187	0.000177	0.000162	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000021_01176.