CAZyme Information: MGYG000000021_01705

Basic Information

• Species: Limosilactobacillus vaginalis_A
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus vaginalis_A
• CAZyme ID: MGYG000000021_01705
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582		63990.41	5.0019

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000021	1945993	Isolate	United Kingdom	Europe

• Gene Location: Start: 16098; End: 17846 Strand: -

Full Sequence      

MKNDYSSNGKVIVYDHSNFNHHAALKSFLPDSFTWTVAVNGDYTISFTAYDDGSEAFSML
TGQNVILDHGEFFVIKQTSDTKANGGTALQISASQVYTELSRHRIASNTYDPDAQQSTAP
TDSDQNNQSDQITLDGTATTVTPDKILHYYIGNANGQNGCGMKWAVHGNFNAQPVVFEAT
DVKSGISKITETWTDAVIYPHGYCVDVYTHDEFYKSYGHRIDYLHDTSQVQLDTDTTVIV
NQVRAVGATYSSSGTGTADTGLPNGALGAGSGAVAADARKYLGVPYVWGGAGGARGGNPY
SGMDCSSFVSQVYKDFGINIPAYTVSMESSFHEIPYSQVTTGDVGFYGSHGHTTHICLML
DHNTMIYEPQPGEKCKTEPVDYFRPSWFARNDQMAAVVAKSSDDSGTAMTETYNDTSAQY
YFQPFIVRDKESIKRWGTFEGEDVTNDTITDAGQMKDYALKQMVLNPSISITVTKITNEK
PIIGEKIRLEIKPINYVTFVNVTGFTWYPYSNSTATTINLNSNPKTILDYDASFHNSTEK
TSTIVNNWQKMTWTKQEVRTFGENIQNANDDSNKSGSTKKSG

Enzyme Prediction     

No EC number prediction in MGYG000000021_01705.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	1.41e-14	283	389	1	102	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
pfam06605	Prophage_tail	1.39e-13	409	534	125	251	Prophage endopeptidase tail. This family is of prophage tail proteins that are probably acting as endopeptidases.
pfam18994	Prophage_tailD1	8.43e-13	11	93	1	82	Prophage endopeptidase tail N-terminal domain. This domain represents the N-terminal domain of prophage tail proteins that are probably acting as endopeptidases. This domain has a RIFT related fold.
NF033741	NlpC_p60_RipA	4.16e-10	235	380	274	442	NlpC/P60 family peptidoglycan endopeptidase RipA.
pfam06605	Prophage_tail	1.67e-09	121	260	3	134	Prophage endopeptidase tail. This family is of prophage tail proteins that are probably acting as endopeptidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY85594.1	3.89e-111	10	565	3	657
QHM66411.1	4.64e-109	10	565	3	657
QHM64692.1	4.64e-109	10	565	3	657
QHM69436.1	4.64e-109	10	565	3	657
QDZ69499.1	1.41e-107	10	565	3	657

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	5.83e-19	273	387	30	138	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
3NE0_A	1.07e-11	259	380	61	199	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
3PBC_A	1.07e-11	259	380	61	199	ChainA, Invasion Protein [Mycobacterium tuberculosis]
4Q4T_A	7.87e-11	259	380	319	457	Structureof the Resuscitation Promoting Factor Interacting protein RipA mutated at E444 [Mycobacterium tuberculosis H37Rv]
3S0Q_A	1.65e-10	259	380	62	200	ChainA, INVASION PROTEIN [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	8.63e-16	273	387	404	512	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
O53168	4.31e-10	259	380	319	457	Peptidoglycan endopeptidase RipA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ripA PE=1 SV=1
A0QX22	9.89e-09	260	380	352	482	Peptidoglycan endopeptidase RipA OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=ripA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000021_01705.