CAZyme Information: MGYG000000022_00228

Basic Information

• Species: Faecalibacterium prausnitzii_C
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_C
• CAZyme ID: MGYG000000022_00228
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000000022_1|CGC4	44322.34	5.0631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000022	3052239	Isolate	United Kingdom	Europe

• Gene Location: Start: 244362; End: 245507 Strand: -

Full Sequence      

MTHEEILTLLGDYVDYLIANSSAEAPMWNIEKVRSGKPNKWNYIDGCMITACLSLYKTTG
DEKYLSFSKDFIDFFVQEDGSIKTYDPKEYNLDNVNQGKNLFTLYDIFGDEKYRRAIDTI
RSQLLTQPRTKEGNFWHKDIYPWQVWLDGTYMAQPFYMEYETRYNKMQGCIDSYKQFMNI
KKHMRDEKTGLYYHGYDESRQMYWADPVTGCSPNFWLRAMGWFMVAMVDVLERMDEQLYN
EYRGIMAQLRQTIEDVHKFQDEETGMFWQVMDHPGVEGNYLETSGTALFAYAVLKGVRLG
YLPKRMAAWAEKAFYGTCDRYLSKNPDGSLQLDGICLVAGLGGKDHRDGSLAYYFSEPVV
CNDAKGVGPLVLAYTEMIARK

Enzyme Prediction     

No EC number prediction in MGYG000000022_00228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	378	2.8e-112	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.23e-94	32	377	24	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.80e-80	39	381	25	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP00557.1	4.41e-297	1	381	1	381
QIA43718.1	4.41e-297	1	381	1	381
AXA82451.1	3.90e-291	1	381	1	381
CBK99741.1	6.47e-290	1	381	1	381
AXB29657.1	1.15e-283	1	381	1	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.49e-102	41	376	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.51e-73	39	377	37	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.34e-73	39	377	27	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.30e-13	41	330	65	338	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.41e-10	128	330	147	339	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	8.28e-73	39	377	37	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.76e-43	152	378	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.76e-43	152	378	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	2.66e-15	41	308	29	285	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000022_00228.