CAZyme Information: MGYG000000022_02083

Basic Information

• Species: Faecalibacterium prausnitzii_C
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_C
• CAZyme ID: MGYG000000022_02083
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823	MGYG000000022_6|CGC2	90926.8	4.8272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000022	3052239	Isolate	United Kingdom	Europe

• Gene Location: Start: 91337; End: 93808 Strand: -

Full Sequence      

MIRQNFNADWTVEKGDGNSRMNSFLGNTQTKTVHLPYDAMIHEARTPDTKNGAQTGFYPG
GEYIFQKHFTAPQAWQGKPVSLVFEGVYQTALVYLNGWLLTRNVNGYAEFTVEAGPYLKY
GADNLLKVIADNSLEPNSRWYTGSGIYRPVRLLVGNKVYLPQDTVRITTREADEGFALLD
VTAQVQSASTVTERVTLQQTICREGTAVLTDRQNLLLQPGESRTVSFRYCVDSPALWSPE
NPNLYTSTMQVLEGEEELDREETGFGIRTLSIDAAHGVRINGQTVKLRGACIHHDNGILG
AATLPDAEERRIRQLKEAGFNAIRSSHHPAGRALLDACDRYGVLVMDELSDVWNVRKNPY
DYALYFEQDWKPTIQKMVAKDYNHPSVILYCVGNEISEAGSESGAETNRRLCNTFRELDP
TRYTTNALNGLMAAGYRLREIMGDVMRKFPAQPGPSGGDGGGSNALNSFMSLMSGEKGDY
FATHPLLTEALSGCEDSCDVIGLNYLTGRHVLEHELHPHKAVLGTETYPADIVRLWHIVE
ENPHMIGDFTWAGYDYLGEAGCGIFHYDGGANFSSIYPERTAYIGDLDLLGNRRPISYLR
EIVYGLRKAPYLAVLRMEHNGQTSSKTPWMFKDNLASWTWPGFEGQTASVDVYSASEEVE
LFLNDASLGRRTVVDFTATYSVPYTPGELKAVGYTGGVCDGEFTLRTAQDAQMTLTADRK
TLQANGEDAAFVMIQFVDANGTADLHTKHTLKVELEGAGILEAVGSANPCSEERYDTPES
ETFDGCCMAVIRAGEAAGEIHLTVTADDSVQKQLTILVQKAEG

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	625	1.7e-99	0.5930851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.15e-57	3	423	12	428	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.97e-36	64	422	112	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	2.50e-35	61	433	65	453	beta-D-glucuronidase; Provisional
PRK09525	lacZ	1.35e-29	59	395	120	462	beta-galactosidase.
pfam18565	Glyco_hydro2_C5	4.66e-29	714	807	2	95	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP00250.1	0.0	1	823	1	823
QIA44023.1	0.0	1	823	1	823
AXB29923.1	0.0	1	823	1	823
ATL90182.1	0.0	1	823	1	823
CBL01206.1	0.0	1	823	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RSK_A	3.97e-141	4	820	8	779	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6B6L_A	5.14e-141	4	803	8	762	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
5T98_A	2.37e-106	6	819	30	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	6.12e-102	1	816	1	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
3GM8_A	9.46e-98	5	818	8	798	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	3.36e-106	3	820	44	850	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	2.94e-73	2	769	47	770	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	3.27e-35	5	761	7	693	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	5.20e-32	3	424	53	466	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	1.14e-30	5	394	30	437	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000022_02083.