CAZyme Information: MGYG000000022_02142

Basic Information

• Species: Faecalibacterium prausnitzii_C
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_C
• CAZyme ID: MGYG000000022_02142
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000000022_6|CGC3	62076.94	4.2276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000022	3052239	Isolate	United Kingdom	Europe

• Gene Location: Start: 146816; End: 148537 Strand: +

Full Sequence      

MILLSCSFLLWSVFFFPLFLPDAMPEHSELIDGDPGLGVYWESKNSFIRNYARLYWRAGA
VRVSCPVQLGGRASGMKPTSFKKSSKNGTGRSIGQAVACLVMAAAITIGGAGTTFLLASQ
PAGLTVEPAALQTEGRVTLPRFDHKSDRSEAKAESTQPEESASSQEQAAASTPAAPVTKA
ENTAAPAESAAPAAEPAVQPEAVPSDPMAGDASEIESENSFPHFLTETEALAAEDPMAAP
EEAAILPETEETAPVAEEAPAASENGEDVLAEAQIKDINGTVLLTPEEIREALDNGTLDE
ESIDPTCLTGENGLLQWLWEFFFGKDEEETPQYSGWRTENGKTYYYDQNTHQTVTGIQSI
DNKLYYFDASGVQQPATFGIDVSKYQSSIDWDKVKTAGVEFAIIRIGYRGYGSGALVQDP
KFEEHFTNARNAGLRVGIYCFSQAVNENEAREEAQACVYVLNGRQLDYPIYFDTEASGAG
NGRADGLGVEDRTKCAVAFCEEVKALGYKPGVYASTTWFRKRLDMSQLSNYYIWNAHYNV
ASSPIACNMWQGTCTARIPGYGGQIDVNISYMG

Enzyme Prediction     

No EC number prediction in MGYG000000022_02142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	380	560	2.7e-45	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.47e-80	378	571	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	5.44e-33	379	569	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	1.39e-31	379	568	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	3.78e-29	380	560	1	179	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	3.47e-25	378	569	1	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP00196.1	0.0	1	573	1	573
ATL90379.1	0.0	1	573	1	572
QIA44074.1	0.0	76	573	1	498
AXA82288.1	4.35e-197	86	573	10	497
CBL00364.1	7.51e-183	86	573	10	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	2.18e-17	379	568	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.33e-16	379	568	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	6.39e-14	368	568	1	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	1.09e-12	368	568	78	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P76421	4.23e-10	372	569	59	253	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	7.63e-10	372	569	59	253	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	7.63e-10	375	569	62	253	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P34020	3.86e-09	379	568	3	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000219	0.999195	0.000137	0.000150	0.000129	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000022_02142.