CAZyme Information: MGYG000000023_00284

Basic Information

• Species: Streptococcus parasanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus parasanguinis
• CAZyme ID: MGYG000000023_00284
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	MGYG000000023_1|CGC3	30384.82	8.7014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000023	2130728	Isolate	United Kingdom	Europe

• Gene Location: Start: 290648; End: 291430 Strand: +

Full Sequence      

MDYRDIHTFVICAYGNSSYLEDCMLSLVNQHNQSSIILYTSTPSLQIEDLCKKYNIVYHH
GNGGSIGKDWNNALSCVKTRYATIAHQDDYYEPQYSELIIKKFQSNPDALIAYSDYFEEK
NGKKIERTLNLKVKRLMLRTINLFPKSKLWRTRVLAFGNAICCPSVSYDLSVLKGFKFDE
KLKGNLDWIAWYQIGKMKGSFVYIDKTLMCHRIHEESETSKTISNNTRSQEDLETLELFW
PKWMAKLLMRQYVKSQNSNN

Enzyme Prediction     

No EC number prediction in MGYG000000023_00284.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	5.11e-08	10	147	2	154	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	2.35e-07	88	220	85	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04196	GT_2_like_d	8.55e-06	10	215	3	206	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13641	Glyco_tranf_2_3	0.001	8	155	5	172	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYF94334.1	3.54e-183	1	260	1	260
QGU81020.1	2.33e-133	7	260	7	260
QBS00384.1	4.48e-131	7	260	7	260
CAD0128217.1	4.48e-131	7	260	7	260
ANS61808.1	4.48e-131	7	260	7	260

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000023_00284.