CAZyme Information: MGYG000000023_00490

Basic Information

• Species: Streptococcus parasanguinis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus parasanguinis
• CAZyme ID: MGYG000000023_00490
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		48668.25	6.8239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000023	2130728	Isolate	United Kingdom	Europe

• Gene Location: Start: 497550; End: 498827 Strand: +

Full Sequence      

MKKIKIDVVAVPLSGHLYPTLNLVKPLLDDPSMEIRVFTGPQKKAVAESLGFTVVPILED
KVEEFERAANNDKKLNLFSAYRQLSKSLDLINHVSDQLLEEWRVNRPDIVIADFITLSAG
FMAEQLEIPWITTMATQFAIETPYGPPCFFGGMGVARTKKEEKIQALCRKLTRIGKYCGA
FLLRKRLKRYNFKLYNQNGVETIYSPYAIFGIGMMELELKTHFPHQYAWLGPLGTSLEKA
EDYPLDLSPYEDKTKVLVTCGTQLPWAKENLLEQTKQLAKEHPECHFFVTLGDGAKEFSE
EEVAPNVTVVSYLPYKEYIPQMDYVIHHGGAGIFYQCIEFKKPALILPHDYDQFDYAIRG
VEAGIAFQAHRNRTEEIQAGFKALLEKESWEKLERLNKLSKTYKPLDTLEFEIQRLLRRG
TDGKL

Enzyme Prediction     

No EC number prediction in MGYG000000023_00490.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	87	416	7.1e-16	0.7931937172774869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	8.55e-31	5	415	3	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	2.80e-30	5	396	2	384	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR01426	MGT	1.07e-10	11	366	3	336	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam04101	Glyco_tran_28_C	7.31e-04	256	351	2	101	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEH55529.1	1.19e-317	1	425	1	425
AFJ26032.1	8.67e-315	1	425	1	425
QWL82965.1	8.67e-315	1	425	1	425
QEW09764.1	6.83e-312	1	425	1	425
QUB38075.1	1.80e-307	1	425	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.37e-12	1	365	1	330	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.40e-12	1	365	1	330	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
7LVY_A	3.34e-06	302	418	339	458	ChainA, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_A Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_B Chain B, UDP-glycosyltransferase 203A2 [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	7.68e-12	1	365	1	330	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000023_00490.