CAZyme Information: MGYG000000024_00293

Basic Information

• Species: Paraclostridium bifermentans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium bifermentans
• CAZyme ID: MGYG000000024_00293
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000000024_1|CGC5	44486.97	9.6158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000024	3641600	Isolate	United Kingdom	Europe

• Gene Location: Start: 285977; End: 287128 Strand: +

Full Sequence      

MGLLFIHDHKFPKFKDEYFCSYGFDDKFCDRYIQNFGKIKIMACHTKANINEKKFSDRIS
ENISFITFNNIKDILKRKVRKQIEEEIKQSEYLIVRLPSFIGLISLMYIKKLNKPYLVEM
VGCSFDALWNHSISGKILAPIMYMLCKKEIKEAPYVVYVTNEFLQKRYPTKGESISCSNV
MLPKNEKDILQNRLKKIQSEKLNKKIILGTCATVGSRYKGQQNVIKAIKVLKEKGYEVEY
QLVGGGDNSYLKNIAKKYNSYENIKFMGVLTHSEVFDWLDSIDIYVQPSLTEGLPRALIE
ALNRGCPAIGSDAGGIPELLVDKSIYPKKSYKKFVYAFEYVNMNKEELALINFKKAKEYE
NNKLEARRSEFFKVFKEFADILN

Enzyme Prediction     

No EC number prediction in MGYG000000024_00293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	204	323	3.1e-22	0.74375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0438	RfaB	1.69e-24	65	378	64	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13692	Glyco_trans_1_4	1.80e-23	205	320	1	112	Glycosyl transferases group 1.
cd03801	GT4_PimA-like	3.31e-22	203	322	191	308	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	1.40e-20	203	322	1	119	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03808	GT4_CapM-like	2.56e-19	161	346	147	331	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ70120.1	5.68e-260	1	383	1	383
QWI13766.1	3.99e-112	1	375	1	380
AOY75603.1	5.43e-112	4	375	4	376
ARE85912.1	5.43e-112	4	375	4	376
AVX07239.1	2.38e-108	1	375	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OKA_A	3.20e-06	219	318	211	316	Crystalstructure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form) [Corynebacterium glutamicum],3OKA_B Crystal structure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form) [Corynebacterium glutamicum]
3OKC_A	3.28e-06	219	318	211	316	Crystalstructure of Corynebacterium glutamicum PimB' bound to GDP (orthorhombic crystal form) [Corynebacterium glutamicum],3OKP_A Crystal structure of Corynebacterium glutamicum PimB' bound to GDP-Man (orthorhombic crystal form) [Corynebacterium glutamicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39859	1.80e-54	1	333	1	329	Protein CapJ OS=Staphylococcus aureus OX=1280 GN=capJ PE=4 SV=1
Q46638	4.74e-11	219	320	236	344	Amylovoran biosynthesis glycosyltransferase AmsK OS=Erwinia amylovora OX=552 GN=amsK PE=3 SV=2
O05083	1.25e-08	58	323	48	298	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
P71243	1.49e-08	219	324	235	348	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) OX=83333 GN=wcaL PE=3 SV=2
P26388	8.27e-08	219	320	235	343	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=wcaL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000024_00293.