CAZyme Information: MGYG000000024_00781

Basic Information

• Species: Paraclostridium bifermentans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium bifermentans
• CAZyme ID: MGYG000000024_00781
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		58331.49	9.835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000024	3641600	Isolate	United Kingdom	Europe

• Gene Location: Start: 798708; End: 800225 Strand: +

Full Sequence      

MIALFNTIIYMSIASTIVVFIIILTRIVIYRRLPSLVSYFLWSILLFRLIVPISFSSEIS
LFNLYPITTKVQSVDYKITNSEYSDNTTEDTKETTYRKDKDSENISYENLAIVWAMVSVL
LIIASVSAYIYTYNKFKEAIVCNELEKDELIKGIIKKEKIKIYKISNLNTPIVCGIFKPK
IIIPNYLLEEKNKKILINVLRHEMVHIRRRDYIIKLIALFITCIYWFNPIIWISLILLHK
DMERSCDEKVIKSSSKDIRREYAQALLTLAIKNKVNVSVLAFGESNTKKRIKGILRYKKS
NFVIKTLCIFVFITIAIFVTTDASSNTKLINFSELKQQNTKNWVELEYISSYVVEAAVVS
QDKDFKNHNGIDATSIIRAAINNMNSANPKQGGSTITQQLVRNVCEFEKNSFFDNKRKEV
FTAIKVDKVYSKNEIMEAYLNCINYGNDIVGIKNASLYYFKKKPSDLTKEESAKLMAIID
NPIMYDPINKKDSNEKKANIILKKI

Enzyme Prediction     

No EC number prediction in MGYG000000024_00781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	334	504	9e-53	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.14e-53	343	504	15	175	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	8.34e-47	343	504	78	239	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam05569	Peptidase_M56	1.92e-45	11	294	6	299	BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.
cd07341	M56_BlaR1_MecR1_like	2.46e-43	113	298	1	187	Peptidase M56-like including those in BlaR1 and MecR1, integral membrane metallopeptidase. This family contains peptidase M56, which includes zinc metalloprotease domain in MecR1 as well as BlaR1. MecR1 is a transmembrane beta-lactam sensor/signal transducer protein that regulates the expression of an altered penicillin-binding protein PBP2a, which resists inactivation by beta-lactam antibiotics, in methicillin-resistant Staphylococcus aureus (MRSA). BlaR1 regulates the inducible expression of a class A beta-lactamase that hydrolytically destroys certain ?-lactam antibiotics in MRSA. Both, MecR1 and BlaR1, are transmembrane proteins that consist of four transmembrane helices, a cytoplasmic zinc protease domain, and the soluble C-terminal extracellular sensor domain, and are highly similar in sequence and function. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. All members contain the zinc metalloprotease motif (HEXXH). Homologs of this peptidase domain are also found in a number of other bacterial genome sequences, most of which are as yet uncharacterized.
PRK00056	mtgA	1.73e-31	334	503	57	221	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA50087.1	2.47e-167	1	505	1	506
BAK56295.1	2.54e-29	322	505	32	213
BAK79624.1	2.54e-29	322	505	32	213
QJS18329.1	2.75e-29	332	503	59	229
QVK21516.1	4.07e-29	343	502	60	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.09e-26	343	505	22	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.50e-26	343	505	22	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3HZS_A	6.36e-20	331	505	10	190	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	6.50e-20	331	505	11	191	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
5ZZK_A	3.41e-19	331	505	46	226	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	7.48e-26	323	502	47	227	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q51005	4.27e-24	343	505	61	222	Biosynthetic peptidoglycan transglycosylase OS=Neisseria gonorrhoeae OX=485 GN=mtgA PE=3 SV=1
Q5F6F6	4.27e-24	343	505	61	222	Biosynthetic peptidoglycan transglycosylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mtgA PE=3 SV=1
B4RJ59	5.85e-24	343	505	61	222	Biosynthetic peptidoglycan transglycosylase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=mtgA PE=3 SV=1
O66874	1.86e-23	343	505	65	226	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
44	66
110	132
216	238
301	323