CAZyme Information: MGYG000000024_02016

Basic Information

• Species: Paraclostridium bifermentans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium bifermentans
• CAZyme ID: MGYG000000024_02016
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	MGYG000000024_1|CGC24	53928.83	4.9572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000024	3641600	Isolate	United Kingdom	Europe

• Gene Location: Start: 2087161; End: 2088534 Strand: -

Full Sequence      

MDYIFPKDFWWGSASSATQMEGAFDIEGKEKNIWDYWFEIAPEKFHNEIGPSDTSQFYYK
YKEDIKLMKELGHNSFRFSISWSRLIKSDGSTNEIAVDFYNDVINTLLENDIEPFINLFH
FDMPMYLQELGGWENRDVVNRYQNFAKLCFELFGDRVKNWFTHNEPIVPVECGYLGEYHY
PAVVDFKRAVQVGYHIMLSSALAIMEYKKLNLEGKIGIIINLTPSYPRSNSKEDLNASNI
ADLILNRSFLDPSVHGEFPNELVEFLKNHNLIPVYKNEDLEIIKNNTVDLLGVNYYQPRR
VKAKESTKGDILTPESFFDFYDMPGKKINPHRGWEIYEKGIYDLAINIRDNYNNIPFYIS
ENGMGVEGEEKFKIDGQINDDYRIEFIKDHLKYVHKAIEEGCNVRGYHLWTFMDNWSWLN
SYKNRYGFVEVNINDEYKRTPKKSAYWFKELIENNGF

Enzyme Prediction     

EC	3.2.1.21	3.2.1.85	3.2.1.86

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	456	1.6e-149	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	3	456	2	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.98e-151	5	457	5	453	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.76e-110	1	454	1	465	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	5.36e-79	5	448	28	476	beta-glucosidase
PRK15014	PRK15014	4.72e-73	5	456	6	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ68624.1	0.0	1	457	1	457
AIF67979.1	3.29e-242	1	457	11	471
AGX06394.1	1.18e-239	1	457	9	469
QFK73164.1	2.52e-239	1	457	1	461
AHA76536.1	4.80e-238	3	457	7	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	1.82e-165	5	455	3	459	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	5.35e-165	5	455	4	460	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	2.30e-137	5	457	20	477	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	6.53e-137	5	457	20	477	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	2.69e-134	5	456	11	449	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	9.60e-239	3	457	7	465	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	3.33e-110	5	457	6	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P10482	8.37e-101	1	456	1	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P22073	6.74e-98	3	455	4	442	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
Q03506	4.01e-97	3	452	4	443	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000024_02016.