CAZyme Information: MGYG000000025_01024

Basic Information

• Species: Staphylococcus nepalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus nepalensis
• CAZyme ID: MGYG000000025_01024
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000000025_3|CGC3	34289.06	10.0907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000025	2822370	Isolate	United Kingdom	Europe

• Gene Location: Start: 289383; End: 290351 Strand: +

Full Sequence      

MRKKIIATAIGTGALAAFNATSADAATTYKVKSGDSLWSIANKYNISVAKLKSLNHLTSN
VIFPNQTLKVSGSTSSNTSTSGSSSSTYTVKSGDSLSSIAAKYGTTYQDIMRLNGLSNHT
IYPGQKLKVSGSAATSGSNTSGSTNGRTITYTVKSGDSLSVIAARYGTTYQKIMSLNGLT
NFNIYPGQKLKISGTASSGTSTGSTGYQTPVFNHSNLYDWGQCTWHVFNKRAQIGKGIST
YWWNANNWDNAAPGDGYTVDHRATVRSILQSDMGYYGHVAFVESVNSNGSITVSEMNYSA
APGVVTYRTIPASQVSSYKYIH

Enzyme Prediction     

No EC number prediction in MGYG000000025_01024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	88	129	1.6e-18	0.95
CBM50	151	193	1.8e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	8.94e-39	207	322	57	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	1.28e-33	26	192	405	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.26e-31	19	192	323	523	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	2.40e-24	210	321	497	616	amidase domain-containing protein.
PRK10783	mltD	4.42e-23	48	190	315	444	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYX88869.1	1.36e-188	1	322	1	321
AQM40788.1	8.69e-185	1	322	1	321
AVL76844.1	3.53e-184	1	322	1	321
QKU19317.1	3.53e-184	1	322	1	321
QKQ06521.1	2.31e-179	1	322	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2LRJ_A	2.88e-35	211	322	4	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
2K3A_A	5.47e-34	208	322	42	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
5T1Q_A	3.93e-18	215	321	245	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	1.74e-08	87	129	4	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	9.76e-07	87	129	4	46	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49UX4	3.10e-178	1	322	1	327	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q2YVT4	5.76e-150	1	322	1	335	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=sle1 PE=3 SV=1
P0C1U7	7.90e-150	1	322	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus OX=1280 GN=sle1 PE=3 SV=1
Q2G0U9	7.90e-150	1	322	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sle1 PE=1 SV=1
Q5HIL2	7.90e-150	1	322	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.999105	0.000158	0.000193	0.000167	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000025_01024.