CAZyme Information: MGYG000000026_00399

Basic Information

• Species: Catenibacterium mitsuokai
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Catenibacterium; Catenibacterium mitsuokai
• CAZyme ID: MGYG000000026_00399
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000000026_6|CGC1	55315.26	5.0759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000026	2527406	Isolate	United Kingdom	Europe

• Gene Location: Start: 59127; End: 60566 Strand: +

Full Sequence      

MSFREDFYWGGATAANQLEGGWQEGGKGISCPDVCTGGTATVSKRITPVLEEGTFYPSHD
AIDHYHRFKEDIALFAEMGFKMYRFSIAWTRIFPNGDEETPNEAGLKFYEELIDECRKYN
IEPLITISHYEVPFNLTKKWNAWADRRMIDCYLNFCKAIFTRYKGKVKYWLTFNEINSAT
TPMGGFLSQGILNEIKTMNFMEQVDNPQNRFQGLHHQFVASALAVKMAHEIDPNYQVGCM
QIMATSYGLTCDPHDQIVNQERNHLMNWFCSDVQCRGAYPNYIKRYFKENNINIVMEEGD
EDILKAGPVDFYTCSYYMSNCQTADKSKEAGSGNILGGVSNPYLKASDWGWQIDPIGLRY
SLNEIWDRYQKPIFVVENGLGAYDKIDEDGKVRDDYRIDYLRSHIEQMHEAVLDGVDLRG
YTPWGCIDLVSASTGEMAKRYGFIFVERYDDGTGDFSRRRKESFYWYQKVIKTNGEDLK

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	475	1.4e-141	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09593	arb	0.0	1	478	4	477	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	1	477	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	0.0	1	478	4	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09852	PRK09852	0.0	2	478	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	0.0	1	478	2	476	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN12512.1	0.0	1	478	1	478
BCL58441.1	0.0	1	479	1	479
QQV06311.1	5.94e-304	1	478	1	479
QPS14428.1	5.94e-304	1	478	1	479
QMW75235.1	5.94e-304	1	478	1	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	5.18e-193	1	478	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	1.70e-191	3	478	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	9.05e-172	5	478	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.58e-171	5	478	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	1.32e-170	3	478	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	2.84e-192	1	478	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	4.71e-186	3	478	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.25e-184	1	478	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	1.80e-173	5	478	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	1.15e-170	3	478	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000026_00399.