CAZyme Information: MGYG000000026_02417

Basic Information

• Species: Catenibacterium mitsuokai
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Catenibacterium; Catenibacterium mitsuokai
• CAZyme ID: MGYG000000026_02417
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000000026_98|CGC1	56785.84	4.9634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000026	2527406	Isolate	United Kingdom	Europe

• Gene Location: Start: 3057; End: 4535 Strand: +

Full Sequence      

MKQLPEGFLWGGATADFQYEGGFNEGGRGLLSHDYETDGSLEHPRAHTLQRADGSIIRPR
SSFFYADPVPQDAKPIFLDDQYYPSHQAVDFYHHYKEDIELMAGMGFNVFRFSICWSRIY
PTGDELTPNEEGLKFYDDVINELEKHGMEPLITICHDEMPMHLAIKYNGWANKHVIDCYV
KYCQTLFERYGSRCKYWLTFNEINAVRGFGPCGTRESDGYTRYLGAHHMFIASAKAVILG
HKMMPDSMFGAMYAMSELYPATCKPEDMFHHMLERRENWYFIDTMARGYYHPYAKEVWAH
HGVESLPITDEEKDILKEGQLDFVSFSYYRSNTTKEGDPWFNVGGSSNPYLENTPWGWPI
DALGLRYCMNEIYDRIQKPIFIVENGMGAIDEADENGYVEDDYRIDYLKKHLSAMADAIN
EDGVDCLGYTMWAPIDLVSLSTGEMKKRYGFIYVDMDDKGHGTLKRTKKKSYNWMKHIIE
TNGAALDDSNSE

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	483	5.2e-137	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	1	487	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	483	1	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	487	3	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	1	486	1	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	5.83e-161	1	486	1	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL57379.1	0.0	1	488	1	488
QKI00193.1	4.48e-314	3	488	4	489
QWX86265.1	4.48e-314	3	488	4	489
SQG80097.1	6.37e-314	3	488	4	489
AQP42793.1	6.37e-314	3	488	4	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.39e-157	2	486	6	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.77e-154	4	486	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	5.76e-148	1	483	4	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.64e-147	1	483	4	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	2.30e-142	2	487	9	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.13e-155	2	486	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	9.68e-154	4	486	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P24240	1.73e-150	1	487	1	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	3.05e-147	1	486	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	7.80e-141	4	487	7	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998093	0.001714	0.000219	0.000003	0.000002	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000026_02417.