CAZyme Information: MGYG000000027_00176

Basic Information

• Species: Mitsuokella jalaludinii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Mitsuokella; Mitsuokella jalaludinii
• CAZyme ID: MGYG000000027_00176
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768		88673.82	6.62

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000027	2393573	Isolate	United Kingdom	Europe

• Gene Location: Start: 184786; End: 187092 Strand: +

Full Sequence      

MKTSELSEFDLYLFHQGTNYHAYEMLGAHFVESDGKKGVRFAVWAPHAKSISVVGDFNEW
DTRVNPMTRGRDGEIWEVFVPGIEEGAIYKYAIEPQWGGPRIMKADPYGFYAEKKPNTAS
RVYDLSKYEWKDGDWFEQKKKESSYERPMLTYEVHAGSWRRTKDGEYLSYRDLADQLIDY
VKKMNYTHIEFMPLCEHPFDGSWGYQITGYYAVTSRFGTPDDFRYLVDKAHENGIAVIMD
WVPGHFCKDEQGLRHFDGQTLYESDNEQLAENWEWGTTNFDYGRTEVQSFLISNAMFWFE
EFHIDGLRIDAVANMLYLNYGRKDGEWTPNKYGDTGNLEAMDFLKKLNESIFKYHPQALM
IAEESTAWPLISKPVYMGGMGFNYKWNMGWMNDMLKYMSLDPIYRKWNHDKVTFSFMYAF
SENFVLPLSHDEVVHGKCSLISKMPGDYWQKFAGLRTFFAYWIAHPGKKLLFMGGEFGQF
IEWNYDDSLDWHLPQQYPMHKKMLEYSRALNKFYCDHKALWQVDFDWNGFQWIDCNDNEN
SVVSFIRKAEDPSDYIVAVCNFTPEVRHDYRIGVPEKGSYIEVFNSDDEAFGGSGVKNEG
EIKTEDVKWHDRDQSILLTIPPMATIYLRHKGQVASGRNSFDEAPAELEVRGHEEKSSAD
KAEAAEAMPKKTVKRRTAAKKVEPSEGAPADKPKRRGRPRMTEEEKAAAKAKREAEKAAK
AAAEGEAAPKKARRRRSTAAKTTARKTTRKTTAKKTASKTAKAAAGES

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	179	479	9.1e-156	0.9966777408637874
CBM48	26	114	2.1e-21	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	1	636	2	633	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	6	629	6	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	6	628	603	1220	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	25	646	26	639	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	6	633	100	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEC00976.1	0.0	1	660	1	661
BAL82148.1	0.0	1	671	1	673
AME04248.1	0.0	1	637	1	637
AKT53144.1	0.0	1	637	1	637
ANR69628.1	0.0	1	665	1	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	8.40e-250	6	629	129	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	2.39e-249	6	629	129	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR0_A	2.39e-249	6	629	129	772	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	4.78e-249	6	629	129	772	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	1.36e-248	6	629	129	772	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	1.24e-300	1	633	1	630	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q1AZ86	6.97e-264	6	629	99	718	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
O66936	1.17e-256	2	632	3	630	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q8DLB8	5.83e-256	2	629	102	749	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q3JCN0	4.26e-254	5	631	110	733	1,4-alpha-glucan branching enzyme GlgB OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000027_00176.