CAZyme Information: MGYG000000027_01889

Basic Information

• Species: Mitsuokella jalaludinii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Mitsuokella; Mitsuokella jalaludinii
• CAZyme ID: MGYG000000027_01889
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214		24697.83	6.6094

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000027	2393573	Isolate	United Kingdom	Europe

• Gene Location: Start: 26854; End: 27498 Strand: +

Full Sequence      

MKRSDFLERVEAARRSLHHKYLCAIVSTAVFLAFAIYLTFASESFQRHYLYPFPYRDAVE
TYADRYRVDPYLAIAVIKTESKFQDDVHSHRGAIGLMQLMPDTAEWIAGQLEDPAYSVEA
IHEPERNIRYGIWYLSSLQREFGGNDVLALAAYNAGRGNVQSWIRDNGWPPDFHNIDAIP
YQETREYVRKVLLTERKYRSLYPAADGTGSGMKD

Enzyme Prediction     

No EC number prediction in MGYG000000027_01889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	67	193	2.6e-31	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.26e-82	52	197	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.64e-60	50	192	1	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.17e-38	70	192	1	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.49e-33	47	202	131	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.74e-31	62	174	4	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL83210.1	2.83e-76	6	203	4	202
SNV00064.1	2.91e-62	42	202	24	184
AME03173.1	1.25e-59	46	202	32	187
QNH55265.1	3.78e-59	46	202	34	189
ANR70625.1	3.78e-59	46	202	34	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.36e-24	54	204	415	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.37e-24	54	204	419	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.40e-24	54	204	425	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.41e-24	54	204	429	575	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.43e-24	54	204	435	581	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	3.54e-21	51	199	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	3.54e-21	51	199	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	3.03e-20	51	199	476	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	2.56e-18	58	191	63	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	3.60e-18	55	197	1422	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	40