CAZyme Information: MGYG000000029_00308

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_00308
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720		84910.91	4.953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 397745; End: 399907 Strand: +

Full Sequence      

MVSCQRNQDPATNTLSEMCERLFPQHAHSFQFQLLTDSVDIDRFTLESDNGKILIKGNNR
NSLAVGLNHYLKYYCQTHVSWYASDSVVMPAQLPEVETPVILRSKCKNRFFLNYCTFGYS
MPYWKWSDWERLIDWMALNGVTMPLAITGQESIWYKVWTEMGLSDEEVRTYFTGPAHLPW
HRMSNVDYWQSPLPQSWLADQEKLQKLILERERAFDMTPILPAFAGHVPAELKELYPEAK
IYTMSQWGGYDEKYRSHFIDPMDSLYSVIQHRFLEEQTKVYGTNHIYGIDPFNEVDSPNW
NEEFLSNVSDKIYKSIQSVDSAAQWLQMTWMFYHAKEKWTQPRIKSFLNAVPQDKLILLD
YYCDYTEIWRDTEQYYGKPYIWCYLGNFGGNTFLAGDLNDVDFKIDRLFKEGGDNVYGLG
VTLEGLDVNPLMYEFVFERAWENSIPVHQWIANWAQCRGGNVDNHIIKAWKQLYEKIYTS
AALCGQAVLMNARPQLEGVEGWNTLPGYDYKNIDLWEIWKELLKAEGVYHSEYHFDVINV
GRQVLGNLFADYRDKFADCYRKKDLEGTKVWGQRMDQLLLDVDRLLCCSPVLSIGKWIKD
ARDFAVNEQEQKYYEENARCILTVWGQKDTQLNDYANRGWGGLTRTFYRERWKRFTEEVI
AAMTRHKNFDEEKFHQDITQFEYEWTLKNEDFPITSGENPISLAKELILKYDDDFHSLYP

Enzyme Prediction     

No EC number prediction in MGYG000000029_00308.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	50	708	4.3e-242	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	109	443	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.07e-87	450	705	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	3.81e-30	17	94	5	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT70725.1	0.0	1	720	1	720
BCA49739.1	0.0	18	720	1	703
ALJ44211.1	0.0	1	715	14	728
QUT41474.1	0.0	1	715	14	728
QQR19002.1	0.0	1	715	14	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	3.99e-135	52	711	51	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	3.83e-96	47	711	208	877	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	4.46e-96	47	711	216	885	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	4.26e-95	47	711	231	900	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	6.94e-136	18	711	52	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	1.92e-135	52	711	74	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_00308.