CAZyme Information: MGYG000000029_00309

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_00309
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		94934.81	7.0561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 399931; End: 402510 Strand: +

Full Sequence      

MKFIIKDILIICLFCCASSLNAQHAFPYKNPLLPTEERVNDLLNRMTLQEKIAQISHLQS
WDVFDGQKLNTAKLAKMCGDKGYGFFEGFPLTAAQCRKNFRIIQTYLLEQTRLGIPGFSV
AESLHGVVHEGSTIYPQNIAIGSTFNPALAYEMTKHIAGELNTIGVKQVLAPCIDVAREL
RWGRVEESFSEDPFLCARMAVAEVKGYMDHGISPMAKHYGPHGNPLGGLNLASVECGIRD
LFDVYLKPFEAILAETDILAVMSSYNAWNREPNSASKFMLTDILRDRFGFRGYVYSDWGV
IDMLKNFHKTADNDFEAASQALTAGLDVEASSLCFKSLESKVLAGEFDVRYIDRAVKRVL
RAKFELGLFEDPYLEKNSYRWPLRSKECISLSRQIADESTVLLKNEGNLLPLDIKKLRSV
AVIGPNADCVQFGDYTWSKNKEDGITPLQGICRLAGKKVKVNYAQGCSIASLNQSGIEEA
VRAAQQSDVALLFVGSSSTAFVRHSNAPSTSGEGIDLSGVELTGAQEELIEAVCATGKPV
VLILVAGKPFAIPFAKKNVPAILVQWYAGEQAGNSIADILFGKVNPSGKISFSFPQSSGH
LPAFYNHLTTDKGFYKEPGTYELPGRDYVFSSPNPLWAFGHGLSYTTFDLVSAIADKTHY
QAHDTIAVKVKIANSGEVVGKEVVQLYIRDVVSTVMTPIKQLKAFEKISLNPAETKEITL
KVPIHELYLTDNIGNRYLEPGTFEIKVGTASDRITHRIFIEVGREPEKTPVIDSPQIIKV
TPSGEFITVQGFVRDAQATPVAYVTVRAISSGQETQTDEKGFYSINLRTDDSIAFVKARF
ITQQMEVKGRKNINIRLVK

Enzyme Prediction     

No EC number prediction in MGYG000000029_00309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	109	329	9.4e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.44e-147	11	759	4	762	beta-glucosidase BglX.
COG1472	BglX	3.78e-82	46	469	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.52e-81	14	762	30	779	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.71e-69	400	645	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.58e-60	47	362	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT70726.1	0.0	1	859	1	859
BCA49740.1	0.0	1	859	1	859
ASW16389.1	0.0	16	859	15	857
QQT79218.1	0.0	16	859	15	857
QUT25566.1	0.0	16	859	15	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	9.06e-158	28	754	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	7.06e-157	28	754	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	5.77e-123	23	754	31	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.88e-105	36	759	4	730	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	5.69e-105	30	759	29	762	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.52e-133	112	751	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.00e-110	28	751	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	3.64e-109	30	759	27	762	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	7.39e-108	30	754	27	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
A7LXU3	8.08e-87	30	748	26	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000699	0.661478	0.337081	0.000286	0.000236	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_00309.