CAZyme Information: MGYG000000029_00313

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_00313
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855		94591.37	8.2847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 407327; End: 409894 Strand: -

Full Sequence      

MIIVSIPFFTTLIVKAQQMLPYQNPQLSVEERVNDLLGRMTLEEKIGQITHLHSYKVFDG
QELNPNKLEVACGNIGYGFFEGFPLTASHCRKNFRRIQEYLIKHTRLGIPGFSVAESLHG
VVHEGATIYPQNIALGSTFNPELAYAKTKHISGELNTMGVKQVLSPCIDVARELRWGRVE
ESFGEDPFLCSAMAVAEVRGYLDHGISPMLKHYGPHGNPSGGLNLASVDCGVRDLFDIYL
KPFETVLAQTRVMAVMSSYNAWNRVPNSASHFMLTEILRNKFGFRGYVYSDWGVVAMLKS
FHKTAGDDFEAARQALEAGLDVEASSPCFETLAKQVKNGNFDIRYINQAVKRVLRAKFGS
GLFEDPFQEKASYHLPLRAKESIQLSRQIADESTVLLKNEGDLLPLDCTKLKSIAVIGPN
ADCVQFGDYTWSKNKSDGITPLQGIRNLLGKRVKINYAKGCSLASMDTTLITEAVKAVHD
SEIALVFVGSSSTAFVRHSNEPSTSGEGIDLSDISLTGAQEQLIRSVCATGKPVVVVLVV
GKPFAIPYIKEKVPAILAQWYAGEQAGNSIADILFGKVNPSGKLPFSFPQSTGHLPAYYN
YLPTDKGYYKEPGTYTSPGRDYVFSSPAPLWTFGHGLSYTRFEYVQATTDKTSYQPHDTI
RISVKVKNSGKLAGKEVVQIYIHDVVSTVMTPVKQLKGFKKIELQPGEEKLVQLKVPVHE
LYLTSNFGDRYLEPGKFEIQVGTSSDEIYYKLPVWVGNKPISLEENSLSKAPVITTGKII
RIEGIVRDVQATPIAGVKVKTINSEEEVMTDAKGSYSLPAHSDDILLFSKKGYASQKVRT
SGQHKINIQMMKENF

Enzyme Prediction     

No EC number prediction in MGYG000000029_00313.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	103	323	6.8e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.75e-155	21	748	23	757	beta-glucosidase BglX.
COG1472	BglX	1.91e-83	40	456	1	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.75e-69	21	742	41	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.78e-65	394	639	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.73e-63	41	356	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW16389.1	0.0	12	852	17	857
QQT79218.1	0.0	12	852	17	857
QUT25566.1	0.0	12	852	17	857
QRP58898.1	0.0	12	852	17	857
SCV06491.1	0.0	12	852	17	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.09e-161	22	748	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	8.52e-161	22	748	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.29e-129	22	748	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.77e-112	30	745	4	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	2.84e-112	24	745	29	754	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.32e-129	8	745	14	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	4.68e-116	22	748	24	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	1.50e-114	22	745	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	4.07e-112	22	748	24	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	1.04e-94	106	838	34	739	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.800346	0.198783	0.000305	0.000224	0.000140	0.000208

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_00313.