CAZyme Information: MGYG000000029_00756

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_00756
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000029_3|CGC4	43526.47	6.3893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 188323; End: 189444 Strand: -

Full Sequence      

MKNNLVLLFFLALTVSVSAQSLPDRKETLEVMKKVNGYFMKKYADYTIPSFYGRVRPSNI
WTRGVYYEGLMSLHSIYPREDYYEYAYDWAAFHKWGMRNGNTTRNADDHCCGQTYIDLYN
ICPQPEMIKNIKLSIDMMVNTPQVNDWWWIDAVQMAMPIFAKFGKMTGEQKYYDKMWDMY
YYTRSQHDETGMFNQKDGLWWRDQDFNPPYKEPNGEDCYWSRGNGWVYAALVRVLNEIPS
DELHRQDYINDFLTMSKALKKCQREDGFWNVSLHDPTNFGGKETSGTALFVYGMAWGVRN
GLLDRSEYLPILLKAWNAMVKDAVHPNGFLGYVQGTGKEPKDGQPVTYKSVPDFEDYGVG
CFLLAGTEVYKLK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	56	371	6.3e-93	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.13e-116	31	373	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.79e-52	31	372	5	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ55827.1	1.28e-279	1	373	1	376
ALJ49019.1	1.38e-279	1	373	3	378
SCV08437.1	1.38e-279	1	373	3	378
QNL41150.1	7.10e-277	1	373	1	376
QIU94565.1	1.95e-274	1	373	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.32e-72	12	368	17	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.94e-64	26	368	14	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.28e-47	147	373	152	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	8.23e-15	57	372	35	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.41e-14	57	372	25	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	3.30e-51	61	373	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	8.23e-47	147	373	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	3.06e-37	105	369	135	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	4.51e-14	57	372	35	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000198	0.999196	0.000153	0.000166	0.000149	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_00756.