CAZyme Information: MGYG000000029_00783

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_00783
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MGYG000000029_3|CGC5	57853.6	5.4506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 237058; End: 238629 Strand: -

Full Sequence      

MMKKYFYFLCITILPLCGVWACSNENTESHDEFGNQGENIPTAIKKLDYGQLLAFPGAEG
HGRSTTGGRGGSVYHVTTLEDNPTNPQKGSFRWALTQKGARTIVFDVAGTIKLKAQLKTT
NDNLTIAGQTSPGGICIADYDFVINSNNVIIRFMRFRPGNVNLDSDGLGGMDKKNIIVDH
CSISWCTDECLSVYGMENSTVQWCLAAQALRDTPSKDKPHGFGGNWGGHYASYHHNMIAH
CESRVPRLGPRPTTLALTECVDIRNNVFYNWAGEGCYGGEDQHVNLVNNYYKPGPATDKA
SSKVQYRIAKIGIYTQEYVQKNPSFAPYAQKWGTFYIDGNVMEGNSGVTVDNWTNGVYAQ
QTNDDKVDNMWTRAAQAGLKLSKPLDYGTVTTHTAEVAYNKVMKYVGCCDYRDKVDNLVI
KDVKNRGASYTASGNLDGYINTPNDIIELGSNSWPELSLDTKRCVIDSDGDGIPDEWEIE
YGLDPNDSSDGNKKMIDVNGKYTNLEMYMNSLVHGIVQDQNAD

Enzyme Prediction     

No EC number prediction in MGYG000000029_00783.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	108	291	9.4e-71	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	4.29e-04	467	488	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
smart00656	Amb_all	7.12e-04	102	187	3	82	Amb_all domain.
pfam03495	Binary_toxB	0.006	466	484	1	20	Clostridial binary toxin B/anthrax toxin PA Ca-binding domain. This domain is a calcium binding domain in the anthrax toxin protective antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT73510.1	3.34e-240	2	521	1	508
ALJ48964.1	4.74e-240	2	521	1	508
QRQ55774.1	4.74e-240	2	521	1	508
QDM11680.1	4.74e-240	2	521	1	508
QUT78068.1	4.74e-240	2	521	1	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PXZ_A	2.95e-10	58	193	25	178	ChainA, Major pollen allergen Jun a 1 [Juniperus ashei],1PXZ_B Chain B, Major pollen allergen Jun a 1 [Juniperus ashei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	9.68e-42	52	513	20	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	4.69e-40	52	513	20	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q0CLG7	5.84e-38	52	513	20	414	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
Q5B297	8.34e-38	52	513	20	411	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
Q4WL88	2.75e-36	52	513	21	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000299	0.158481	0.841027	0.000063	0.000072	0.000067

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_00783.