CAZyme Information: MGYG000000029_00846

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_00846
• CAZy Family: CBM88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	MGYG000000029_4|CGC1	56327.41	4.9732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 28353; End: 29885 Strand: -

Full Sequence      

MTKRWSLLLCFAFSMFSTACSSNEDTQKQEPSTPEVDEVVARAQQPVKVVCVGNSITEGF
GNTCQEKAWPGQLGKLLGSGYTVLNCGVSGTTMFKNSDAPYWNTDRFIKAKEANPQILII
ALGTNDADPWRWNQLKEEFKPNYLDMVAEFRQNGKDPIIYVCLAPPLFGPDKAPQNQMVE
TELIPRVKEIAGEIGAYIIDFHQPLLGASNEFPDNVHPDDAGSALMAQIAYNKIKDAQVI
KPNISVTKGEIIKESIAVVEKGSTVTFKPEPAKGNWKWNGPQGFTSTDRIIKLENVQRGG
TYTAVYTDMTGNRSIINFLVSIKGEQGSTITPQVQDMQGRWAKSSFIRVNPGGNVTLAPE
VENEKDGSWAWTGPENFFAGTREVRLQTVLPTQAGKYTATYTDDYGRQSSIDFTITVEGT
TICPELISYINYGGWKNVSEMEVKEGDSVTFGPHPSNGDWHWEGPDGFTSDRREATVSNF
NSQKAGEYIGTFTNAVGCRVELTITLKLKK

Enzyme Prediction     

No EC number prediction in MGYG000000029_00846.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM88	330	417	3.9e-30	0.9883720930232558
CBM88	430	507	4.5e-28	0.9069767441860465
CBM88	240	322	1.5e-24	0.9883720930232558

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01827	sialate_O-acetylesterase_like1	3.39e-57	47	234	1	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam13472	Lipase_GDSL_2	4.19e-27	51	225	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd04501	SGNH_hydrolase_like_4	5.02e-22	47	234	1	183	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd00229	SGNH_hydrolase	3.37e-21	49	233	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01834	SGNH_hydrolase_like_2	4.83e-17	48	229	3	187	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72758.1	0.0	1	510	4	513
AWI67008.1	5.57e-78	30	320	261	555
AWI66997.1	5.57e-78	30	320	261	555
AIQ68306.1	6.79e-29	42	235	1771	1969
QNK55088.1	1.64e-27	25	235	2105	2307

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EV35	3.64e-26	39	235	266	480	Acetylxylan esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axeA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_00846.