CAZyme Information: MGYG000000029_00968

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_00968
• CAZy Family: GH20
• CAZyme Description: N,N'-diacetylchitobiase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828		95095.03	6.5721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 216274; End: 218760 Strand: +

Full Sequence      

MSKVINISLILCTFMVVIGCELSNRKAPVSVSWQVSVPDINKSNNNEHRFVIKNISNTPL
SRNWSLFYSQFPMKSCKQQSNMVKVENVKGTFHRISPKENYKLLNPGDSIILIISGRGEM
PGYSMKPEGVYWVDESHSSTPLPVELVTRSLPFIYSKNEKAIQVYKDNKRIESAMKHANG
IEVIPAVKHVSYSQSYLKLKNVIHIVAHPDFHTEVAIMKDKLASLYAIVEDSLSEVQLTL
DYLQQKENAVNEEYYELNVTNDKIHISAITPHGIFNGIQTFLSLLKGQEAPYSIKSVFIK
DYPDFSYRGHMQDVARNFIGITDLKKLIDILSSYKLNVFRFHFSDDEGWRLQIPGLEELT
EIASRRGHTYDESECLYPAYNGNFDYQSETSGNGFYSRDEFIDLLRYAADRHVSIIPEIE
SPGHARAAIVAMKARYERYLETDPIKAHEYLLNDIHDASHYVSAQGYSDNVMNVAMPSTY
RFMKKVIQELQLMYEEAGVPLKSIHIGGDEVAEGAWQGSPICKDFMLEYSMTDVQELSDY
FIMRIVDFLKEQKIPFSGWQEVVLGHDEISERYLTDNAFGISCWRTSANNHSDELIYKFA
NKGYPVILSNATNFYLDLAYDAHPDEPGHNWNGYVDESKSFALLPYCIYRSIRTHLLANQ
KQEEKTSLTAEGRKNIKGVESALWSETIRNYKGVEYYLFPKIMGLAERGWHSSPIWESMT
GIDEQLAFEKDLAFYYKRISQKEIPYWDKMNINYRLPFPGLYIDKDGFLFANTPIWGGEI
HYTTDGKEPTKNSKIWNKPVKCRTNEVKAKLFVGNKKSVTVSMNSQFN

Enzyme Prediction     

No EC number prediction in MGYG000000029_00968.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	300	712	1.3e-94	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	0.0	301	717	1	422	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	3.00e-107	305	721	1	355	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	7.52e-102	305	711	1	344	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	4.03e-97	153	825	99	720	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	2.65e-61	305	710	1	314	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40218.1	2.73e-314	11	820	14	830
QIU93708.1	6.08e-313	11	820	13	829
QDH57289.1	2.63e-312	11	823	12	833
CBK66445.1	5.89e-312	11	823	25	846
QDH53746.1	8.33e-311	19	820	22	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	1.73e-89	255	786	262	821	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	4.60e-89	255	786	262	821	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	2.35e-88	255	786	262	821	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	3.93e-75	165	758	126	641	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	4.96e-74	165	758	123	638	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04786	1.44e-101	52	787	47	810	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P13670	1.56e-90	61	787	80	847	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
Q54468	2.15e-88	255	786	289	848	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P49007	4.24e-81	246	717	270	732	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P96155	9.28e-67	218	709	177	604	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000080	0.079639	0.920234	0.000024	0.000028	0.000024

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_00968.