CAZyme Information: MGYG000000029_01994

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_01994
• CAZy Family: PL6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754	MGYG000000029_9|CGC3	83253.65	7.204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 106036; End: 108300 Strand: +

Full Sequence      

MMIRNIHKAIIALLLIGLPSVSFAKRYDVTLPEVASCLKTAQPGDQIYIKDGQYKDMQLK
WIGKGTEKSPITIEALNPGKVKVEGGSTLRIAGEWLSVSGLHFTDGYAPKGSVIEFRNGQ
ELANHCRLTNCVIDKFNPSRRDQAYSYILLYGRHNRVDHCSLTGKLNLGVTLIVILNDER
CLENHHQIDHNYFGERPVYGSNGAETMRVGTSQQAYSSSNTVIENNLFERCSGEVEVISI
KSSDNIIRNNTLLECEGVVALRHGDRNTVNDNLFIGNGRRNTGGIRVVNAGHQIYDNVLV
GLAGTRFFSALGVMDAVPNSLPNRYCQVVDVKMYRNTFVDCTNIEFGTGKDMERTLAPEK
VSFTDNIIINKELDQPYIAVDNVAGIQFKDNKVQLAKNYSAPGFTTEKVKAPQLPDDAVI
RKDKGASWFKNQVAHPVANVRKEYNVSPEANLSEVIHSAEPGGVIILAKGTYPIQRAIFI
DKPLTIRAADAANKPLVRFNGDKPDNMVTIADGGKLVIENITFDGVLEPGKALAKAGIST
AFDMIQPYTLTVDGCEFQNFGEGGFFAIKGTKATFAESVTIRNCLFRDLSGDAINYAAEK
DDIGRYNADDMLIENCSFYRLLGLPINIYRGGSDESTAGPYITVRHCTFVDCCNKERGSV
MRLIGPQVLTVENCNFDNSGRGGATIRLDEATWEKVRIANCNLWNSGRMMTTTSQAIQGK
MYNFRPAYINAEAYDYTPVEGSELEKLSIGLKKK

Enzyme Prediction     

No EC number prediction in MGYG000000029_01994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL6	32	393	3.2e-131	0.967741935483871
PL6	447	656	4.3e-40	0.5994236311239193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14251	PL-6	2.80e-179	30	393	3	366	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.
pfam14592	Chondroitinas_B	7.68e-123	33	416	6	405	Chondroitinase B. This family includes chondroitinases. These enzymes cleave the glycosaminoglycan dermatan sulfate.
pfam16318	DUF4957	1.25e-11	470	595	1	119	Domain of unknown function (DUF4957). This family consists of uncharacterized proteins around 150 residues in length and is mainly found in various Bacteroides and Prevotella species. The function of this protein is unknown.
pfam05048	NosD	9.01e-06	216	301	91	174	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	1.30e-05	549	686	33	144	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26279.1	0.0	1	754	1	754
QIU93442.1	0.0	1	751	1	751
QNL39961.1	0.0	1	753	1	753
QNT66846.1	3.00e-242	4	710	5	705
QEC55801.1	1.68e-234	28	744	19	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DMK_A	1.07e-237	29	744	15	733	ChainA, BcAlyPL6 [Bacteroides clarus],7DMK_B Chain B, BcAlyPL6 [Bacteroides clarus],7DMK_C Chain C, BcAlyPL6 [Bacteroides clarus],7DMK_D Chain D, BcAlyPL6 [Bacteroides clarus]
5GKD_A	3.82e-137	38	679	15	678	Structureof PL6 family alginate lyase AlyGC [Paraglaciecola chathamensis],5GKD_B Structure of PL6 family alginate lyase AlyGC [Paraglaciecola chathamensis],5GKD_C Structure of PL6 family alginate lyase AlyGC [Paraglaciecola chathamensis],5GKD_D Structure of PL6 family alginate lyase AlyGC [Paraglaciecola chathamensis]
5GKQ_A	2.97e-136	38	679	15	678	Structureof PL6 family alginate lyase AlyGC mutant-R241A [Paraglaciecola chathamensis S18K6],5GKQ_B Structure of PL6 family alginate lyase AlyGC mutant-R241A [Paraglaciecola chathamensis S18K6]
7O77_A	4.18e-126	38	679	14	678	ChainA, Poly(Beta-D-mannuronate) lyase [Pseudoalteromonas atlantica T6c]
7O7T_A	4.18e-126	38	679	14	678	ChainA, Poly(Beta-D-mannuronate) lyase [Pseudoalteromonas atlantica T6c]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q06365	7.44e-83	43	394	2	346	Alginate lyase OS=Pseudomonas sp. (strain OS-ALG-9) OX=86038 GN=aly PE=3 SV=1
Q46079	6.72e-26	38	340	38	349	Chondroitinase-B OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999005	0.000211	0.000160	0.000158	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_01994.