CAZyme Information: MGYG000000029_02126

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_02126
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1131	MGYG000000029_10|CGC2	129264.46	7.0024

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 73740; End: 77135 Strand: -

Full Sequence      

MLLLLLFFNISVKERGTKCPFVRLLDMKKKERMKIYTLLLGALFVSPTQAQIMHDWENHH
VLQINREPARAAFTPFSVQKGDGSISLDGTWKFRWTPVPNERVMNFYQTNFDDKDWTDFP
VPANWEVNGYGTPIYVSAGYPFKIDPPRVMGEPKTDYTTYKERNPVGQYRRTFVLPTGWE
VNGQTFLRFEGVMSAFYVWINGERVGYSQGSMEPSEFNVTKYLKSGENQISLEVYRYSDG
SYLEDQDFWRFGGIHRSIHLIHTPDIHVRDYAVRTLPASVGDYKDFILQIDPQFSAYRGM
TGKGYVLQGVLKDASGKEVATLKGDVEDILDLEHKASRMNEWYPQRGPRKMGRLSAIIKS
PERWTAETPYLYKLHLTLQNEEGKVVEQIEQAVGFRSVEIKKGQLLVNGNPVRFRGVNRH
EHDPRTARVMSEERMLQDILLMKQANINAVRTSHYPNVSRWYELCDSLGLYVMDEADIEE
HGLRGTLASTPDWHAAFMDRAVRMAERDKNYPCIVMWSMGNESGYGPNFAAISAWLHDFD
PTRPVHYEGAQGVDGNPDPKTVDVISRFYTRVKQEYLNPGIAEGEDKERAENARWERLLE
IAERTNDDRPVMTSEYAHSMGNALGNFKEYWDEIYSNPRMLGGFIWDWVDQGIYKTLPDG
RTMVAYGGDFGDKPNLKAFCFNGLQMSDRETTPKYWEVKKVYAPVELRVENGELRVTNRN
HHIDLSLYRCLWTLSVDGKEKERGEITLPEIAPGESKTIDLPAFRSLKGAYSLSNKSEEI
SKTNKKTEKTLSDSQLKVSIVLKSDALWAKARHEVAWEQFCLQKGDLASTDLINKGALQV
KEDDKSLLISGRSFSVQWEKKVNGSMTSLIYKNKEMLAHSDDFPVQPVTQVFRAPTDNDK
SFGNWLAKDWKLHGMDHPQINLESFHHEKRADGAVIVRIQTSNLYKEGKVVTTSVYTVFS
DGTIDLKTTFLPQGVLPEIPRLGIAFCLAPAYDTFTWYGRGPQDNYPDRKTSAMIGLWKG
SVAKQYVHYPRPQDSGNKEEVHYLTLTDKQNKGIRIDAVENAFSASALHYTVQDIYEETH
DCNLKPRAEIILSMDAAVLGLGNSSCGPGVLKKYAIEKKEHTLHIRISSKQ

Enzyme Prediction     

No EC number prediction in MGYG000000029_02126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	82	1015	5.5e-228	0.9627659574468085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	47	1114	6	1011	beta-galactosidase.
PRK10340	ebgA	0.0	53	1114	1	984	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	6.13e-166	68	1016	1	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.21e-104	398	705	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	3.25e-93	850	1127	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT23626.1	0.0	33	1131	1	1099
QRN01912.1	0.0	27	1131	1	1105
SCV09660.1	0.0	27	1131	1	1105
ALJ45325.1	0.0	33	1131	1	1099
QRQ56951.1	0.0	33	1131	1	1099

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.01e-204	54	1127	2	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.04e-204	54	1127	3	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6CVM_A	1.40e-178	55	1116	14	1008	Atomicresolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_B Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_C Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_D Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6X1Q_A 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_B 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_C 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_D 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12]
1JZ7_A	2.08e-178	55	1116	15	1009	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]
1PX3_A	2.08e-178	55	1116	15	1009	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	5.70e-204	54	1127	3	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	4.94e-201	38	1102	2	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q7MG04	6.51e-184	55	1126	12	1025	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q9K9C6	6.16e-183	86	1117	47	1000	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
Q8D4H3	5.53e-182	55	1128	12	1028	Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.914777	0.046018	0.038762	0.000223	0.000102	0.000123

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_02126.