CAZyme Information: MGYG000000029_02518

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_02518
• CAZy Family: GH76
• CAZyme Description: Cellobiose 2-epimerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43355.04	7.3971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 74538; End: 75671 Strand: -

Full Sequence      

MLFSLASATGKTPKNNRYLSIADSVLNNVLNLYHTADGLLTETYPVNPDQKITYLAGGIQ
QNGMLKASFLWPYSGMMSGCVALYKATGNKKYKKILENRILAGMNQYWDDSRQPACYQSY
PTKYGQHGRYYDDNIWIALDYCDYYGLTHHPAYLEKAVALYQYIYSGWSDELGGGIFWCE
QQKEGKHTCSNAPSAVLGVKLYRLTKDSKYLEKAKETYAWTKKNLCDPNDHLYWDNINLK
GNIAKEKYAYNSGQMIQAGVLLYEETGDEQYLRDAQQTAAGTDTFFRTKADKKDPTFKVH
KDMAWFNVILFRGLKALYKIDKNPAYVNAMVENVLHAWENYRDENGLLGRDWSGHKEEPY
KWLLDNACLIEFFAEIN

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	60	356	1.7e-79	0.8128491620111732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.07e-36	60	314	24	288	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	5.78e-18	129	359	90	330	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
COG1331	YyaL	4.05e-04	200	287	422	505	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam07470	Glyco_hydro_88	8.10e-04	199	361	39	186	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT78429.1	3.35e-267	1	376	1	376
QDM11358.1	4.70e-267	1	376	10	385
AAO77738.1	4.70e-267	1	376	10	385
QMW85074.1	4.70e-267	1	376	10	385
QUT27044.1	1.94e-266	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	8.71e-234	18	377	4	363	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	3.74e-59	70	374	169	489	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4C1S_A	2.83e-54	68	376	43	367	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
4V1S_A	1.96e-30	46	353	57	362	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	2.39e-28	46	353	57	362	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.942302	0.056848	0.000431	0.000168	0.000080	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_02518.