CAZyme Information: MGYG000000029_02524

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_02524
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	MGYG000000029_13|CGC2	52083.08	4.5121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 86643; End: 88031 Strand: +

Full Sequence      

MKNYISLSKKALLLGGAFVMFTSCDDGDLADIYKGSSSGEYVSDVNWTEAANKSTETYIK
YFFENAGGRNTFAGEIYWEKPNTPETGEPVSTGGSGGWSQGHALDIVTDAYVRHADNSEY
QTYLYENIMKPFLPAFDEWNRTCGYGGNDFWNNFYDDMEWMALACLRVYELTGDQDYYSA
LMKMWDHIKGAKNDYKGVGGMAWKTDLPASRMSCSNGPGCLLAMKLYQLTVTEAKDGWED
KAAYYLNFAKEVYNWMTAYLCDTSTGQVYDNLGIRDDGTPGDPDKVALSYNQGTFMASAL
ALYNATGEEEYLRNAVAFGSYQVNKKMDSNYPVFSGEGNSGDNLLFRGIFVRYFLDMVKQ
PVSSLYPEKTKTKFIAALRSCSDVLWTLAHPEGYYVWEYDWAKAPTFGNRNNREDRLTIS
LNAEVPGATLIEIRARYEDWVQGKTTEKANWIGPEFGKKAEE

Enzyme Prediction     

No EC number prediction in MGYG000000029_02524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	50	407	1.3e-69	0.9134078212290503

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	6.79e-26	47	423	3	348	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	6.38e-23	98	382	36	318	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
pfam07221	GlcNAc_2-epim	0.001	164	321	148	307	N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase). This family contains a number of eukaryotic and bacterial N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase) enzymes (EC:5.3.1.8) approximately 500 residues long. This converts N-acyl-D-glucosamine to N-acyl-D-mannosamine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ55352.1	0.0	1	462	1	463
SCV07928.1	0.0	1	462	1	463
QUT32576.1	0.0	1	462	1	463
QDM11364.1	0.0	1	462	1	463
QUT78423.1	0.0	1	462	1	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	4.43e-45	98	361	89	327	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.23e-43	98	361	90	328	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	8.86e-43	98	361	90	328	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	6.60e-30	47	438	3	341	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	2.59e-25	98	402	39	318	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000007	1.000036	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_02524.