CAZyme Information: MGYG000000029_02744

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_02744
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000000029_16|CGC1	40942.3	5.0079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 12299; End: 13381 Strand: +

Full Sequence      

MKNIYNFLIYFIFCGIGAGCSSSSGEDFPVPEPEPVDNSLIKKELCTEGASVEAKKVYTY
LRNCWGRKTLSSTMANVAWNVNEAIWVNRQTGKHPAIACFDYMNLPASPADWIDYNKTSV
VEDWWNAGGLVAACWHWNVPVTENSSEYKCMISETDFDIAKALQEGTRENEIIKADLEEL
AGYLLLLKQKNIPVIWRPLHEAAGKWFWWGKDAASYKRLWKLVYETFKQKGLNNLIWVWT
SETNDRDWYPGDAYVDIIGRDVYHKTSAAGLATDFDALKKAFPDKLIALSECGDVATIDK
QLAAGAQWAWFMTWYDYEVTKDTTAPVFNSGQHEHADKAWWNNAFSQPGVICRSDLPSFK

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	48	353	1.2e-87	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.99e-48	47	318	2	286	Glycosyl hydrolase family 26.
COG4124	ManB2	4.71e-14	191	263	179	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR45659.1	8.83e-266	1	360	1	360
QRQ58989.1	7.25e-265	1	360	1	360
SCV06948.1	7.25e-265	1	360	1	360
ALJ47537.1	7.25e-265	1	360	1	360
AHW58761.1	1.77e-132	41	360	41	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	3.58e-266	1	360	1	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	7.73e-77	45	356	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	1.25e-72	35	356	87	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3WDQ_A	3.84e-55	47	359	36	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	5.45e-49	41	316	141	418	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	1.17e-52	44	360	145	461	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	2.62e-45	41	316	170	447	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55298	1.90e-43	41	360	152	463	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	2.61e-42	39	360	152	465	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55296	3.70e-41	38	360	150	464	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000102	0.999937	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_02744.