CAZyme Information: MGYG000000029_03047

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_03047
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	MGYG000000029_19|CGC3	48102.31	7.6615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 52252; End: 53556 Strand: +

Full Sequence      

MKNVVLSLLLLGTYITGYAQVAQSPYQTIVSADGSGNFRTIQAAINAVPDGRTEPWMILL
KNGSYNEQVVIPESKPYIHLIGQDREKTIIHLNLNVGGKITGRESEGKRAYWKSSVHNPS
SPVYKYEGTVVLVEGDHFYAENISFVNDWGVEAENGPQALAMSSQADCVSFNNCKFRSFQ
DTWMTANDDLSRHYVKDCWIEGAVDYFYGGGNVLLENCTLYNVRSGAVIVAPAHKNAKYG
YAFRDCIIDGNSLASDGRVKLGRPWHNSPKAIYINTTMRIPIAAEGWTDMGTIPGSFAEY
NSRDMQGNVLDLSKRKTNYQYKDRASGEIISGKCRATLTKTEAAEYTYENMIPGDDNWNP
RGIMEELRAPRNLIYQQGTLTWQPVKNAIGYIIYDGEQIIGTTTATAFPVLKVNYALKVS
AVNKSGSQGKKGVL

Enzyme Prediction     

No EC number prediction in MGYG000000029_03047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	307	9.8e-75	0.8993055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.57e-43	30	291	9	250	pectinesterase
pfam01095	Pectinesterase	1.23e-42	29	355	3	298	Pectinesterase.
PLN02665	PLN02665	4.18e-41	22	301	63	322	pectinesterase family protein
PLN02432	PLN02432	2.01e-39	30	358	15	291	putative pectinesterase
PLN02304	PLN02304	3.75e-37	30	315	79	347	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40736.1	3.90e-263	1	434	1	434
QUT27001.1	3.90e-263	1	434	1	434
QDH54169.1	3.90e-263	1	434	1	434
QDM11324.1	2.25e-262	1	434	1	434
SCV07880.1	2.25e-262	1	434	1	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	1.54e-23	26	360	4	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	1.16e-21	29	354	10	304	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.89e-20	30	302	11	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
3UW0_A	3.24e-20	10	290	17	306	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	4.76e-20	30	302	11	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.74e-35	30	291	9	250	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43043	1.78e-33	20	358	51	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
O23038	4.51e-32	30	315	93	361	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q8GXA1	1.89e-31	29	287	259	499	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LY17	3.39e-31	20	289	58	301	Probable pectinesterase 50 OS=Arabidopsis thaliana OX=3702 GN=PME50 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998918	0.000207	0.000177	0.000169	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_03047.